Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5365050..5365675 | Replicon | chromosome |
Accession | NZ_OW969912 | ||
Organism | Klebsiella variicola isolate 0 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1F2M041 |
Locus tag | LQ196_RS25855 | Protein ID | WP_008807903.1 |
Coordinates | 5365050..5365433 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LQ196_RS25860 | Protein ID | WP_162550505.1 |
Coordinates | 5365433..5365675 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ196_RS25840 (AN2340V1_4952) | 5362416..5363318 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
LQ196_RS25845 (AN2340V1_4953) | 5363315..5363950 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ196_RS25850 (AN2340V1_4954) | 5363947..5364876 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
LQ196_RS25855 (AN2340V1_4955) | 5365050..5365433 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ196_RS25860 (AN2340V1_4956) | 5365433..5365675 | - | 243 | WP_162550505.1 | CopG family transcriptional regulator | Antitoxin |
LQ196_RS25865 (AN2340V1_4957) | 5365880..5366797 | + | 918 | WP_032741512.1 | alpha/beta hydrolase | - |
LQ196_RS25870 (AN2340V1_4958) | 5366812..5367753 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
LQ196_RS25875 (AN2340V1_4959) | 5367798..5368235 | - | 438 | WP_008807906.1 | D-aminoacyl-tRNA deacylase | - |
LQ196_RS25880 (AN2340V1_4960) | 5368232..5369092 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
LQ196_RS25885 (AN2340V1_4961) | 5369086..5369685 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T296228 WP_008807903.1 NZ_OW969912:c5365433-5365050 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|