Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4879935..4880451 | Replicon | chromosome |
| Accession | NZ_OW969912 | ||
| Organism | Klebsiella variicola isolate 0 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | LQ196_RS23550 | Protein ID | WP_002886902.1 |
| Coordinates | 4879935..4880219 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | LQ196_RS23555 | Protein ID | WP_002886901.1 |
| Coordinates | 4880209..4880451 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ196_RS23535 (AN2340V1_4518) | 4875038..4876693 | + | 1656 | WP_008807132.1 | alpha,alpha-phosphotrehalase | - |
| LQ196_RS23540 (AN2340V1_4519) | 4877079..4879217 | + | 2139 | WP_044614392.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQ196_RS23545 (AN2340V1_4520) | 4879467..4879931 | + | 465 | WP_022065402.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQ196_RS23550 (AN2340V1_4521) | 4879935..4880219 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ196_RS23555 (AN2340V1_4522) | 4880209..4880451 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQ196_RS23560 (AN2340V1_4523) | 4880529..4882439 | - | 1911 | WP_032731805.1 | PRD domain-containing protein | - |
| LQ196_RS23565 (AN2340V1_4524) | 4882462..4883616 | - | 1155 | WP_012969087.1 | lactonase family protein | - |
| LQ196_RS23570 (AN2340V1_4525) | 4883742..4884482 | - | 741 | WP_032731803.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T296226 WP_002886902.1 NZ_OW969912:c4880219-4879935 [Klebsiella variicola]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |