Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1770117..1770707 | Replicon | chromosome |
| Accession | NZ_OW969912 | ||
| Organism | Klebsiella variicola isolate 0 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | LQ196_RS08515 | Protein ID | WP_008804165.1 |
| Coordinates | 1770375..1770707 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | LQ196_RS08510 | Protein ID | WP_012541132.1 |
| Coordinates | 1770117..1770374 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ196_RS08490 (AN2340V1_1625) | 1765726..1766301 | + | 576 | WP_032730762.1 | hypothetical protein | - |
| LQ196_RS08495 (AN2340V1_1626) | 1766479..1767315 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
| LQ196_RS08500 (AN2340V1_1627) | 1767521..1768492 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
| LQ196_RS08505 (AN2340V1_1628) | 1768489..1769589 | - | 1101 | WP_117110384.1 | AarF/UbiB family protein | - |
| LQ196_RS08510 (AN2340V1_1629) | 1770117..1770374 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| LQ196_RS08515 (AN2340V1_1630) | 1770375..1770707 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LQ196_RS08525 (AN2340V1_1631) | 1771030..1772466 | + | 1437 | WP_042948427.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| LQ196_RS08535 (AN2340V1_1632) | 1772839..1774293 | - | 1455 | WP_008804170.1 | AMP nucleosidase | - |
| LQ196_RS08540 (AN2340V1_1633) | 1774424..1774669 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T296218 WP_008804165.1 NZ_OW969912:1770375-1770707 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |