Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 787363..788052 | Replicon | chromosome |
Accession | NZ_OW969912 | ||
Organism | Klebsiella variicola isolate 0 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | LQ196_RS03890 | Protein ID | WP_230138433.1 |
Coordinates | 787714..788052 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | LQ196_RS03885 | Protein ID | WP_230138432.1 |
Coordinates | 787363..787689 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ196_RS03860 (AN2340V1_0740) | 783251..783718 | - | 468 | WP_230138429.1 | zinc-ribbon domain-containing protein | - |
LQ196_RS03865 (AN2340V1_0741) | 783984..784199 | - | 216 | WP_154924526.1 | AlpA family phage regulatory protein | - |
LQ196_RS03870 (AN2340V1_0742) | 784309..784956 | - | 648 | WP_230138430.1 | inovirus Gp2 family protein | - |
LQ196_RS03875 (AN2340V1_0743) | 785675..786643 | + | 969 | WP_230138431.1 | hypothetical protein | - |
LQ196_RS03880 (AN2340V1_0744) | 786847..787320 | + | 474 | WP_049130829.1 | DNA repair protein RadC | - |
LQ196_RS03885 (AN2340V1_0745) | 787363..787689 | + | 327 | WP_230138432.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ196_RS03890 (AN2340V1_0746) | 787714..788052 | + | 339 | WP_230138433.1 | TA system toxin CbtA family protein | Toxin |
LQ196_RS03895 (AN2340V1_0747) | 788166..788993 | + | 828 | WP_230138434.1 | DUF4942 domain-containing protein | - |
LQ196_RS03900 (AN2340V1_0748) | 789335..790723 | - | 1389 | WP_060619870.1 | MFS transporter | - |
LQ196_RS03905 (AN2340V1_0749) | 790853..791782 | + | 930 | WP_029602171.1 | LysR family transcriptional regulator | - |
LQ196_RS03910 (AN2340V1_0750) | 792140..792943 | - | 804 | WP_032731230.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12793.76 Da Isoelectric Point: 8.5135
>T296216 WP_230138433.1 NZ_OW969912:787714-788052 [Klebsiella variicola]
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDENVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQSQLPSIR
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDENVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQSQLPSIR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|