Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 762127..762784 | Replicon | chromosome |
| Accession | NZ_OW969912 | ||
| Organism | Klebsiella variicola isolate 0 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | LQ196_RS03765 | Protein ID | WP_002916310.1 |
| Coordinates | 762374..762784 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | LQ196_RS03760 | Protein ID | WP_002916312.1 |
| Coordinates | 762127..762393 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ196_RS03735 (AN2340V1_0717) | 758458..759192 | - | 735 | WP_015703423.1 | MurR/RpiR family transcriptional regulator | - |
| LQ196_RS03740 (AN2340V1_0718) | 759243..759554 | + | 312 | WP_015703422.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ196_RS03745 (AN2340V1_0719) | 759719..760378 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| LQ196_RS03750 | 760444..760851 | + | 408 | WP_230138420.1 | hypothetical protein | - |
| LQ196_RS03755 (AN2340V1_0720) | 760898..761881 | - | 984 | WP_032731234.1 | tRNA-modifying protein YgfZ | - |
| LQ196_RS03760 (AN2340V1_0721) | 762127..762393 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| LQ196_RS03765 (AN2340V1_0722) | 762374..762784 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| LQ196_RS03770 (AN2340V1_0723) | 762791..763312 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
| LQ196_RS03775 (AN2340V1_0724) | 763413..764309 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
| LQ196_RS03780 (AN2340V1_0725) | 764332..765045 | + | 714 | WP_008806425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ196_RS03785 (AN2340V1_0726) | 765051..766784 | + | 1734 | WP_064166671.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T296215 WP_002916310.1 NZ_OW969912:762374-762784 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |