Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 315522..316108 Replicon chromosome
Accession NZ_OW969912
Organism Klebsiella variicola isolate 0

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LQ196_RS01445 Protein ID WP_002920800.1
Coordinates 315740..316108 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag LQ196_RS01440 Protein ID WP_023298302.1
Coordinates 315522..315743 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ196_RS01420 (AN2340V1_0276) 311671..312597 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LQ196_RS01425 (AN2340V1_0277) 312594..313871 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
LQ196_RS01430 (AN2340V1_0278) 313868..314635 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQ196_RS01435 (AN2340V1_0279) 314637..315350 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQ196_RS01440 (AN2340V1_0280) 315522..315743 + 222 WP_023298302.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ196_RS01445 (AN2340V1_0281) 315740..316108 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQ196_RS01450 (AN2340V1_0282) 316400..317716 + 1317 WP_008806974.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQ196_RS01455 (AN2340V1_0283) 317823..318710 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQ196_RS01460 (AN2340V1_0284) 318707..319552 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQ196_RS01465 (AN2340V1_0285) 319554..320624 + 1071 WP_072045659.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 300492..321361 20869


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296213 WP_002920800.1 NZ_OW969912:315740-316108 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8123.14 Da        Isoelectric Point: 4.7769

>AT296213 WP_023298302.1 NZ_OW969912:315522-315743 [Klebsiella variicola]
MKTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure

References