Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 151155..152056 Replicon plasmid P1
Accession NZ_OW969905
Organism Citrobacter freundii isolate 0

Toxin (Protein)


Gene name - Uniprot ID A0A837LJP8
Locus tag LQ142_RS25835 Protein ID WP_007372300.1
Coordinates 151155..151613 (-) Length 153 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag LQ142_RS25840 Protein ID WP_008786588.1
Coordinates 151610..152056 (-) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ142_RS25790 (AI3057V1_5036) 146836..147123 + 288 WP_016241556.1 hypothetical protein -
LQ142_RS25795 (AI3057V1_5037) 147134..147532 + 399 WP_007372292.1 hypothetical protein -
LQ142_RS25800 (AI3057V1_5038) 147616..147942 + 327 WP_007372293.1 hypothetical protein -
LQ142_RS25805 (AI3057V1_5040) 148305..148643 - 339 WP_007372294.1 hypothetical protein -
LQ142_RS25810 (AI3057V1_5041) 148881..149324 + 444 WP_007372295.1 hypothetical protein -
LQ142_RS25815 (AI3057V1_5042) 149443..149784 + 342 WP_007372296.1 hypothetical protein -
LQ142_RS25820 (AI3057V1_5043) 149943..150497 + 555 WP_007372297.1 hypothetical protein -
LQ142_RS25825 (AI3057V1_5044) 150547..150813 + 267 WP_007372298.1 hypothetical protein -
LQ142_RS25830 (AI3057V1_5045) 150881..151111 - 231 WP_007372299.1 hypothetical protein -
LQ142_RS25835 (AI3057V1_5046) 151155..151613 - 459 WP_007372300.1 RES family NAD+ phosphorylase Toxin
LQ142_RS25840 (AI3057V1_5047) 151610..152056 - 447 WP_008786588.1 DUF2384 domain-containing protein Antitoxin
LQ142_RS25845 (AI3057V1_5048) 152205..152522 + 318 WP_007372302.1 hypothetical protein -
LQ142_RS25850 (AI3057V1_5049) 152564..153406 + 843 WP_007372303.1 hypothetical protein -
LQ142_RS25855 (AI3057V1_5050) 153378..153656 + 279 WP_007372304.1 hypothetical protein -
LQ142_RS25860 (AI3057V1_5051) 153716..154159 + 444 WP_007372305.1 hypothetical protein -
LQ142_RS25865 (AI3057V1_5052) 154446..154610 + 165 WP_007372306.1 hypothetical protein -
LQ142_RS25870 (AI3057V1_5053) 155178..156020 + 843 WP_007372307.1 HNH endonuclease signature motif containing protein -
LQ142_RS25875 156442..156693 + 252 WP_024196080.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..191011 191011


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(95-145)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 16975.40 Da        Isoelectric Point: 4.5730

>T296211 WP_007372300.1 NZ_OW969905:c151613-151155 [Citrobacter freundii]
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK

Download         Length: 459 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16689.02 Da        Isoelectric Point: 6.9812

>AT296211 WP_008786588.1 NZ_OW969905:c152056-151610 [Citrobacter freundii]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837LJP8

Antitoxin

Source ID Structure

References