Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 143856..144406 Replicon plasmid P1
Accession NZ_OW969905
Organism Citrobacter freundii isolate 0

Toxin (Protein)


Gene name ccdB Uniprot ID S1EZ93
Locus tag LQ142_RS25765 Protein ID WP_007372286.1
Coordinates 144098..144406 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1FMC3
Locus tag LQ142_RS25760 Protein ID WP_007372285.1
Coordinates 143856..144095 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ142_RS25730 139972..140223 - 252 WP_001515736.1 hypothetical protein -
LQ142_RS25735 (AI3057V1_5023) 140282..140986 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ142_RS25740 (AI3057V1_5024) 141336..141476 + 141 WP_007372281.1 hypothetical protein -
LQ142_RS25745 (AI3057V1_5025) 141492..142124 + 633 WP_007372282.1 hypothetical protein -
LQ142_RS25750 (AI3057V1_5027) 142582..143256 + 675 WP_008786597.1 hypothetical protein -
LQ142_RS25755 (AI3057V1_5028) 143253..143717 + 465 WP_008786596.1 hypothetical protein -
LQ142_RS25760 (AI3057V1_5029) 143856..144095 + 240 WP_007372285.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ142_RS25765 (AI3057V1_5030) 144098..144406 + 309 WP_007372286.1 CcdB family protein Toxin
LQ142_RS25770 (AI3057V1_5031) 144427..144585 + 159 WP_016241558.1 hypothetical protein -
LQ142_RS25775 (AI3057V1_5032) 144740..145294 + 555 WP_007372288.1 hypothetical protein -
LQ142_RS25780 (AI3057V1_5033) 145364..145981 + 618 WP_007372289.1 hypothetical protein -
LQ142_RS25785 (AI3057V1_5034) 146064..146534 + 471 WP_007372290.1 HAD domain-containing protein -
LQ142_RS25790 (AI3057V1_5036) 146836..147123 + 288 WP_016241556.1 hypothetical protein -
LQ142_RS25795 (AI3057V1_5037) 147134..147532 + 399 WP_007372292.1 hypothetical protein -
LQ142_RS25800 (AI3057V1_5038) 147616..147942 + 327 WP_007372293.1 hypothetical protein -
LQ142_RS25805 (AI3057V1_5040) 148305..148643 - 339 WP_007372294.1 hypothetical protein -
LQ142_RS25810 (AI3057V1_5041) 148881..149324 + 444 WP_007372295.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..191011 191011
- flank IS/Tn - - 140282..140986 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11351.17 Da        Isoelectric Point: 8.5044

>T296210 WP_007372286.1 NZ_OW969905:144098-144406 [Citrobacter freundii]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8784.97 Da        Isoelectric Point: 8.6387

>AT296210 WP_007372285.1 NZ_OW969905:143856-144095 [Citrobacter freundii]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ93

Antitoxin

Source ID Structure
AlphaFold DB S1FMC3

References