296209

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 42601..43120 Replicon plasmid P1
Accession NZ_OW969905
Organism Citrobacter freundii isolate 0

Toxin (Protein)


Gene name parE Uniprot ID A0A837F4A9
Locus tag LQ142_RS25125 Protein ID WP_000277490.1
Coordinates 42601..42885 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A6P1V8C3
Locus tag LQ142_RS25130 Protein ID WP_000124732.1
Coordinates 42878..43120 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ142_RS25100 (AI3057V1_4896) 38571..38969 + 399 WP_230126885.1 hypothetical protein -
LQ142_RS25105 (AI3057V1_4897) 38966..40054 + 1089 WP_230126882.1 IS3 family transposase -
LQ142_RS25110 (AI3057V1_4898) 40044..40691 - 648 WP_230128418.1 recombinase family protein -
LQ142_RS25115 (AI3057V1_4899) 41027..42049 + 1023 WP_001567660.1 IS110 family transposase -
LQ142_RS25120 42371..42463 + 93 Protein_54 plasmid partition protein ParG -
LQ142_RS25125 (AI3057V1_4900) 42601..42885 - 285 WP_000277490.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LQ142_RS25130 (AI3057V1_4901) 42878..43120 - 243 WP_000124732.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
LQ142_RS25135 (AI3057V1_4902) 43338..44042 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ142_RS25140 44095..44205 + 111 Protein_58 GlxA family transcriptional regulator -
LQ142_RS25145 (AI3057V1_4903) 44325..44615 + 291 WP_016241603.1 antibiotic biosynthesis monooxygenase family protein -
LQ142_RS25150 (AI3057V1_4904) 44583..44756 - 174 WP_166488550.1 hypothetical protein -
LQ142_RS25155 (AI3057V1_4905) 44788..45768 + 981 WP_181633734.1 IS5-like element ISKpn26 family transposase -
LQ142_RS25160 (AI3057V1_REPA000000176) 45906..46109 + 204 Protein_62 IS3 family transposase -
LQ142_RS25165 (AI3057V1_4907) 46126..47289 + 1164 WP_023336801.1 1,3-propanediol dehydrogenase -
LQ142_RS25170 (AI3057V1_4908) 47310..47663 + 354 WP_086801900.1 glycerol dehydratase reactivase beta/small subunit family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..191011 191011
- inside IScluster/Tn - - 30284..52380 22096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11005.52 Da        Isoelectric Point: 6.2103

>T296209 WP_000277490.1 NZ_OW969905:c42885-42601 [Citrobacter freundii]
VYKLTERAADDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHTVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8875.01 Da        Isoelectric Point: 7.0130

>AT296209 WP_000124732.1 NZ_OW969905:c43120-42878 [Citrobacter freundii]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVIAGLESGESSLSLRDIAAQRKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837F4A9

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V8C3

References