Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4909903..4910519 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | LQ142_RS24010 | Protein ID | WP_003028682.1 |
Coordinates | 4909903..4910277 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | LQ142_RS24015 | Protein ID | WP_043018956.1 |
Coordinates | 4910277..4910519 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS23995 (4907406) | 4907406..4908308 | + | 903 | WP_106107909.1 | formate dehydrogenase O subunit beta | - |
LQ142_RS24000 (4908305) | 4908305..4908940 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ142_RS24005 (4908937) | 4908937..4909866 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
LQ142_RS24010 (4909903) | 4909903..4910277 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ142_RS24015 (4910277) | 4910277..4910519 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
LQ142_RS24020 (4910725) | 4910725..4911633 | + | 909 | WP_048234226.1 | alpha/beta hydrolase | - |
LQ142_RS24025 (4911784) | 4911784..4912725 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
LQ142_RS24030 (4912770) | 4912770..4913207 | - | 438 | WP_003840439.1 | D-aminoacyl-tRNA deacylase | - |
LQ142_RS24035 (4913204) | 4913204..4914076 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
LQ142_RS24040 (4914070) | 4914070..4914669 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T296208 WP_003028682.1 NZ_OW969904:c4910277-4909903 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |