Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4758115..4758781 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | LQ142_RS23325 | Protein ID | WP_134214823.1 |
Coordinates | 4758422..4758781 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | LQ142_RS23320 | Protein ID | WP_134214821.1 |
Coordinates | 4758115..4758432 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS23280 (4753403) | 4753403..4754227 | + | 825 | WP_048216971.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
LQ142_RS23285 (4754295) | 4754295..4755518 | + | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
LQ142_RS23290 (4755520) | 4755520..4756332 | + | 813 | WP_134214817.1 | shikimate 5-dehydrogenase | - |
LQ142_RS23295 (4756366) | 4756366..4756683 | - | 318 | WP_054527950.1 | CcdB family protein | - |
LQ142_RS23300 (4756683) | 4756683..4756976 | - | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
LQ142_RS23305 (4757073) | 4757073..4757438 | - | 366 | WP_134214819.1 | hypothetical protein | - |
LQ142_RS23310 (4757570) | 4757570..4757743 | + | 174 | WP_032938222.1 | hypothetical protein | - |
LQ142_RS23315 (4757814) | 4757814..4757975 | + | 162 | WP_003841416.1 | phage protein | - |
LQ142_RS23320 (4758115) | 4758115..4758432 | - | 318 | WP_134214821.1 | helix-turn-helix transcriptional regulator | Antitoxin |
LQ142_RS23325 (4758422) | 4758422..4758781 | - | 360 | WP_134214823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ142_RS23330 (4758995) | 4758995..4759684 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
LQ142_RS23335 (4759831) | 4759831..4761462 | - | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13456.53 Da Isoelectric Point: 10.2555
>T296207 WP_134214823.1 NZ_OW969904:c4758781-4758422 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|