Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4480753..4481269 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | LQ142_RS22005 | Protein ID | WP_003839578.1 |
Coordinates | 4480753..4481037 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | LQ142_RS22010 | Protein ID | WP_003839576.1 |
Coordinates | 4481027..4481269 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS21990 (4477078) | 4477078..4477662 | + | 585 | WP_230128069.1 | fructose PTS transporter subunit IIA | - |
LQ142_RS21995 (4478040) | 4478040..4480178 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
LQ142_RS22000 (4480285) | 4480285..4480749 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
LQ142_RS22005 (4480753) | 4480753..4481037 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ142_RS22010 (4481027) | 4481027..4481269 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LQ142_RS22015 (4481347) | 4481347..4483260 | - | 1914 | WP_106107776.1 | BglG family transcription antiterminator | - |
LQ142_RS22020 (4483282) | 4483282..4484022 | - | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
LQ142_RS22025 (4484019) | 4484019..4485137 | - | 1119 | WP_048234082.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
LQ142_RS22030 (4485121) | 4485121..4486254 | - | 1134 | WP_230128072.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T296206 WP_003839578.1 NZ_OW969904:c4481037-4480753 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |