Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4417173..4417972 | Replicon | chromosome |
| Accession | NZ_OW969904 | ||
| Organism | Citrobacter freundii isolate 0 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W3D2T8 |
| Locus tag | LQ142_RS21705 | Protein ID | WP_045405101.1 |
| Coordinates | 4417173..4417550 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ142_RS21710 | Protein ID | WP_045405099.1 |
| Coordinates | 4417613..4417972 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ142_RS21675 (4413073) | 4413073..4413435 | + | 363 | WP_230128056.1 | endoribonuclease SymE | - |
| LQ142_RS21680 (4413594) | 4413594..4414466 | + | 873 | WP_134216258.1 | HNH endonuclease | - |
| LQ142_RS21685 (4414595) | 4414595..4415392 | - | 798 | WP_047359029.1 | helix-turn-helix transcriptional regulator | - |
| LQ142_RS21690 (4415536) | 4415536..4416381 | - | 846 | WP_045405106.1 | DUF4942 domain-containing protein | - |
| LQ142_RS21695 (4416452) | 4416452..4416655 | - | 204 | WP_023312607.1 | DUF957 domain-containing protein | - |
| LQ142_RS21700 (4416685) | 4416685..4417176 | - | 492 | WP_045405103.1 | DUF5983 family protein | - |
| LQ142_RS21705 (4417173) | 4417173..4417550 | - | 378 | WP_045405101.1 | TA system toxin CbtA family protein | Toxin |
| LQ142_RS21710 (4417613) | 4417613..4417972 | - | 360 | WP_045405099.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ142_RS21715 (4418023) | 4418023..4418667 | - | 645 | WP_045405098.1 | hypothetical protein | - |
| LQ142_RS21720 (4418677) | 4418677..4418898 | - | 222 | WP_045405097.1 | DUF987 domain-containing protein | - |
| LQ142_RS21725 (4418910) | 4418910..4419389 | - | 480 | WP_045405095.1 | DNA repair protein RadC | - |
| LQ142_RS21730 (4419400) | 4419400..4419879 | - | 480 | WP_080461205.1 | antirestriction protein | - |
| LQ142_RS21735 (4420004) | 4420004..4420228 | - | 225 | WP_230128059.1 | hypothetical protein | - |
| LQ142_RS21740 (4420228) | 4420228..4421046 | - | 819 | WP_045405091.1 | DUF932 domain-containing protein | - |
| LQ142_RS21745 (4421162) | 4421162..4421413 | - | 252 | WP_023312599.1 | DUF905 family protein | - |
| LQ142_RS21750 (4421410) | 4421410..4422081 | - | 672 | WP_045405089.1 | EcsC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.87 Da Isoelectric Point: 6.8696
>T296205 WP_045405101.1 NZ_OW969904:c4417550-4417173 [Citrobacter freundii]
MQTQSIHPVRATASRPSPVDIWQTLLTYLLEQHYGLTLNDTPFGNDRVIQEHIEAGISLCDGVNFIVEKYELVRIDRHGF
STETQSPLIGSIDILRARKATGLMTRNDYKVVTDITTGKYSGGTR
MQTQSIHPVRATASRPSPVDIWQTLLTYLLEQHYGLTLNDTPFGNDRVIQEHIEAGISLCDGVNFIVEKYELVRIDRHGF
STETQSPLIGSIDILRARKATGLMTRNDYKVVTDITTGKYSGGTR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13267.07 Da Isoelectric Point: 4.5637
>AT296205 WP_045405099.1 NZ_OW969904:c4417972-4417613 [Citrobacter freundii]
MPDINTTQNDNMDAPSWGLHRDITPCFGARLVQEGNCLHYLADRASITGQFSEADLRHLDQVFPLMLKQLELMLVSGELN
PRHQHCVTLYYNGLICEADTLGSCGYIYLAIYPGEPPAA
MPDINTTQNDNMDAPSWGLHRDITPCFGARLVQEGNCLHYLADRASITGQFSEADLRHLDQVFPLMLKQLELMLVSGELN
PRHQHCVTLYYNGLICEADTLGSCGYIYLAIYPGEPPAA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|