Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3805098..3805718 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | LQ142_RS18865 | Protein ID | WP_002892050.1 |
Coordinates | 3805500..3805718 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | LQ142_RS18860 | Protein ID | WP_003021733.1 |
Coordinates | 3805098..3805472 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS18850 (3800244) | 3800244..3801437 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ142_RS18855 (3801460) | 3801460..3804609 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
LQ142_RS18860 (3805098) | 3805098..3805472 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
LQ142_RS18865 (3805500) | 3805500..3805718 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
LQ142_RS18870 (3806025) | 3806025..3806576 | + | 552 | WP_230127886.1 | maltose O-acetyltransferase | - |
LQ142_RS18875 (3806693) | 3806693..3807163 | + | 471 | WP_119173998.1 | YlaC family protein | - |
LQ142_RS18880 (3807242) | 3807242..3807382 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
LQ142_RS18885 (3807384) | 3807384..3807644 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
LQ142_RS18890 (3807833) | 3807833..3809386 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
LQ142_RS18895 (3809438) | 3809438..3809791 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
LQ142_RS18900 (3809856) | 3809856..3810485 | - | 630 | WP_003021707.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296204 WP_002892050.1 NZ_OW969904:3805500-3805718 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT296204 WP_003021733.1 NZ_OW969904:3805098-3805472 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |