Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2479324..2479963 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A8B5QF36 |
Locus tag | LQ142_RS12195 | Protein ID | WP_003020221.1 |
Coordinates | 2479324..2479500 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ142_RS12200 | Protein ID | WP_123924900.1 |
Coordinates | 2479547..2479963 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS12175 (2476102) | 2476102..2476332 | - | 231 | WP_003020233.1 | DUF2554 family protein | - |
LQ142_RS12180 (2476522) | 2476522..2476647 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
LQ142_RS12185 (2476647) | 2476647..2477657 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
LQ142_RS12190 (2477657) | 2477657..2479060 | - | 1404 | WP_003020224.1 | cytochrome ubiquinol oxidase subunit I | - |
LQ142_RS12195 (2479324) | 2479324..2479500 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LQ142_RS12200 (2479547) | 2479547..2479963 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LQ142_RS12205 (2480056) | 2480056..2481465 | + | 1410 | WP_003836140.1 | PLP-dependent aminotransferase family protein | - |
LQ142_RS12210 (2481793) | 2481793..2482938 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
LQ142_RS12215 (2482955) | 2482955..2483971 | + | 1017 | WP_003020210.1 | ABC transporter ATP-binding protein | - |
LQ142_RS12220 (2483972) | 2483972..2484916 | + | 945 | WP_003843727.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T296203 WP_003020221.1 NZ_OW969904:2479324-2479500 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT296203 WP_123924900.1 NZ_OW969904:2479547-2479963 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|