Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 791622..792425 Replicon chromosome
Accession NZ_OW969904
Organism Citrobacter freundii isolate 0

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7L6TYH6
Locus tag LQ142_RS03815 Protein ID WP_047358707.1
Coordinates 791622..792002 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7L6TXP6
Locus tag LQ142_RS03820 Protein ID WP_047358708.1
Coordinates 792060..792425 (-) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ142_RS03785 (787314) 787314..788519 + 1206 WP_230126895.1 restriction endonuclease subunit S -
LQ142_RS03790 (788864) 788864..789325 + 462 WP_230126896.1 hypothetical protein -
LQ142_RS03795 (789328) 789328..789549 + 222 WP_040229952.1 helix-turn-helix transcriptional regulator -
LQ142_RS03800 (789964) 789964..790812 - 849 WP_047358705.1 DUF4942 domain-containing protein -
LQ142_RS03805 (790893) 790893..791060 - 168 WP_072058785.1 DUF957 domain-containing protein -
LQ142_RS03810 (791134) 791134..791625 - 492 WP_047358706.1 DUF5983 family protein -
LQ142_RS03815 (791622) 791622..792002 - 381 WP_047358707.1 TA system toxin CbtA family protein Toxin
LQ142_RS03820 (792060) 792060..792425 - 366 WP_047358708.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ142_RS03825 (792447) 792447..792668 - 222 WP_047358709.1 DUF987 domain-containing protein -
LQ142_RS03830 (792682) 792682..793161 - 480 WP_047358710.1 DNA repair protein RadC -
LQ142_RS03835 (793174) 793174..793647 - 474 WP_047358733.1 antirestriction protein -
LQ142_RS03840 (793916) 793916..794734 - 819 WP_047358711.1 DUF932 domain-containing protein -
LQ142_RS03845 (794852) 794852..795103 - 252 WP_047358712.1 DUF905 family protein -
LQ142_RS03850 (795294) 795294..795761 - 468 WP_047358713.1 hypothetical protein -
LQ142_RS03855 (795858) 795858..796259 - 402 WP_047358714.1 hypothetical protein -
LQ142_RS03860 (796465) 796465..797352 - 888 WP_047358715.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 788864..822318 33454


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-110)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14216.38 Da        Isoelectric Point: 10.0929

>T296197 WP_047358707.1 NZ_OW969904:c792002-791622 [Citrobacter freundii]
MQTLSAIPTRKAPSHPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEKIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS

Download         Length: 381 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13417.25 Da        Isoelectric Point: 6.4780

>AT296197 WP_047358708.1 NZ_OW969904:c792425-792060 [Citrobacter freundii]
MSNQLPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPALLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAMYPTPDNSITR

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6TYH6

Antitoxin

Source ID Structure
AlphaFold DB A0A7L6TXP6

References