Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yafW/CbtA-CbeA |
Location | 684361..685084 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | LQ142_RS03305 | Protein ID | WP_181506521.1 |
Coordinates | 684764..685084 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | - |
Locus tag | LQ142_RS03300 | Protein ID | WP_230126870.1 |
Coordinates | 684361..684696 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS03280 (679386) | 679386..680399 | + | 1014 | WP_109846053.1 | SIR2 family protein | - |
LQ142_RS03285 (680409) | 680409..682142 | + | 1734 | WP_085119320.1 | ATP-binding protein | - |
LQ142_RS03290 (682475) | 682475..683374 | - | 900 | WP_230126868.1 | SMEK domain-containing protein | - |
LQ142_RS03295 (683867) | 683867..684346 | + | 480 | WP_063941847.1 | DNA repair protein RadC | - |
LQ142_RS03300 (684361) | 684361..684696 | + | 336 | WP_230126870.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ142_RS03305 (684764) | 684764..685084 | + | 321 | WP_181506521.1 | TA system toxin CbtA family protein | Toxin |
LQ142_RS03310 (685198) | 685198..686031 | + | 834 | WP_230126872.1 | DUF4942 domain-containing protein | - |
LQ142_RS03320 (686335) | 686335..686841 | + | 507 | WP_016151005.1 | G/U mismatch-specific DNA glycosylase | - |
LQ142_RS03325 (686872) | 686872..688869 | - | 1998 | WP_016151004.1 | TonB-dependent receptor | - |
LQ142_RS03330 (688880) | 688880..689929 | - | 1050 | WP_003846277.1 | YncE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 644961..686031 | 41070 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12150.85 Da Isoelectric Point: 6.4795
>T296195 WP_181506521.1 NZ_OW969904:684764-685084 [Citrobacter freundii]
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHNESAIREHIEAGITLADALNFLVERYELIRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHNESAIREHIEAGITLADALNFLVERYELIRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|