Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 246459..247090 | Replicon | chromosome |
| Accession | NZ_OW969904 | ||
| Organism | Citrobacter freundii isolate 0 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0J1MPQ6 |
| Locus tag | LQ142_RS01155 | Protein ID | WP_003837806.1 |
| Coordinates | 246459..246734 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ142_RS01160 | Protein ID | WP_205688252.1 |
| Coordinates | 246731..247090 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ142_RS01145 (242510) | 242510..245257 | + | 2748 | WP_172750167.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| LQ142_RS01150 (245257) | 245257..246381 | + | 1125 | WP_071687967.1 | ABC transporter permease | - |
| LQ142_RS01155 (246459) | 246459..246734 | + | 276 | WP_003837806.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LQ142_RS01160 (246731) | 246731..247090 | + | 360 | WP_205688252.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LQ142_RS01165 (247203) | 247203..247604 | - | 402 | WP_032937232.1 | nickel-responsive transcriptional regulator NikR | - |
| LQ142_RS01170 (247654) | 247654..248232 | - | 579 | WP_230126760.1 | 4'-phosphopantetheinyl transferase AcpT | - |
| LQ142_RS01175 (248295) | 248295..249344 | - | 1050 | WP_003023393.1 | AI-2E family transporter | - |
| LQ142_RS01180 (249478) | 249478..250695 | + | 1218 | WP_230126762.1 | MFS transporter | - |
| LQ142_RS01185 (250699) | 250699..251256 | - | 558 | WP_003837816.1 | DcrB family lipoprotein | - |
| LQ142_RS01190 (251329) | 251329..251994 | - | 666 | WP_003837818.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10210.88 Da Isoelectric Point: 10.7228
>T296193 WP_003837806.1 NZ_OW969904:246459-246734 [Citrobacter freundii]
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13214.98 Da Isoelectric Point: 4.5462
>AT296193 WP_205688252.1 NZ_OW969904:246731-247090 [Citrobacter freundii]
MIKPKTPNSMEISGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
MIKPKTPNSMEISGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|