Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4499624..4500443 | Replicon | chromosome |
Accession | NZ_OW969781 | ||
Organism | Klebsiella oxytoca isolate 328 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | LQ195_RS21100 | Protein ID | WP_004110819.1 |
Coordinates | 4500186..4500443 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | LQ195_RS21095 | Protein ID | WP_210669405.1 |
Coordinates | 4499624..4500175 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ195_RS21070 (AN2363V1_4133) | 4494694..4495242 | - | 549 | WP_004099233.1 | type 1 fimbrial major subunit FimA | - |
LQ195_RS21075 (AN2363V1_4134) | 4495615..4496382 | + | 768 | WP_004099232.1 | winged helix-turn-helix domain-containing protein | - |
LQ195_RS21080 (AN2363V1_4135) | 4497010..4497687 | + | 678 | WP_135800006.1 | sigma-70 region 4 domain-containing protein | - |
LQ195_RS21085 | 4497978..4498742 | - | 765 | WP_224227635.1 | class I SAM-dependent methyltransferase | - |
LQ195_RS21090 | 4499118..4499510 | - | 393 | Protein_4150 | class I SAM-dependent methyltransferase | - |
LQ195_RS21095 (AN2363V1_4137) | 4499624..4500175 | - | 552 | WP_210669405.1 | N-acetyltransferase | Antitoxin |
LQ195_RS21100 (AN2363V1_4138) | 4500186..4500443 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
LQ195_RS21105 (AN2363V1_4139) | 4501024..4502208 | + | 1185 | WP_004099225.1 | mannonate dehydratase | - |
LQ195_RS21110 (AN2363V1_4140) | 4502283..4503758 | + | 1476 | WP_047720344.1 | fructuronate reductase | - |
LQ195_RS21115 (AN2363V1_4141) | 4503894..4504670 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T296191 WP_004110819.1 NZ_OW969781:c4500443-4500186 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20158.97 Da Isoelectric Point: 6.8799
>AT296191 WP_210669405.1 NZ_OW969781:c4500175-4499624 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHSSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHSSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|