Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4260836..4261455 | Replicon | chromosome |
Accession | NZ_OW969781 | ||
Organism | Klebsiella oxytoca isolate 328 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | LQ195_RS19970 | Protein ID | WP_004099646.1 |
Coordinates | 4261237..4261455 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LQ195_RS19965 | Protein ID | WP_004099648.1 |
Coordinates | 4260836..4261210 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ195_RS19955 (AN2363V1_3911) | 4255992..4257185 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ195_RS19960 (AN2363V1_3912) | 4257208..4260354 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LQ195_RS19965 (AN2363V1_3913) | 4260836..4261210 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
LQ195_RS19970 (AN2363V1_3914) | 4261237..4261455 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
LQ195_RS19975 (AN2363V1_3915) | 4261616..4262182 | + | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
LQ195_RS19980 | 4262151..4262288 | - | 138 | WP_224226357.1 | hypothetical protein | - |
LQ195_RS19985 (AN2363V1_3916) | 4262319..4262789 | + | 471 | WP_004111038.1 | YlaC family protein | - |
LQ195_RS19990 (AN2363V1_3917) | 4262764..4264218 | - | 1455 | WP_064371883.1 | PLP-dependent aminotransferase family protein | - |
LQ195_RS19995 (AN2363V1_3918) | 4264321..4265019 | + | 699 | WP_004099639.1 | GNAT family protein | - |
LQ195_RS20000 (AN2363V1_3919) | 4265016..4265156 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQ195_RS20005 (AN2363V1_3920) | 4265156..4265419 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T296190 WP_004099646.1 NZ_OW969781:4261237-4261455 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT296190 WP_004099648.1 NZ_OW969781:4260836-4261210 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|