Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 873559..874216 | Replicon | chromosome |
Accession | NZ_OW969781 | ||
Organism | Klebsiella oxytoca isolate 328 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | LQ195_RS04215 | Protein ID | WP_004105559.1 |
Coordinates | 873806..874216 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | LQ195_RS04210 | Protein ID | WP_004105561.1 |
Coordinates | 873559..873825 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ195_RS04185 (AN2363V1_0816) | 868738..870171 | - | 1434 | WP_004105576.1 | 6-phospho-beta-glucosidase | - |
LQ195_RS04190 (AN2363V1_0817) | 870292..871020 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
LQ195_RS04195 (AN2363V1_0818) | 871071..871376 | + | 306 | WP_230133524.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ195_RS04200 (AN2363V1_0819) | 871544..872203 | + | 660 | WP_004105569.1 | hemolysin III family protein | - |
LQ195_RS04205 (AN2363V1_0820) | 872332..873315 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
LQ195_RS04210 (AN2363V1_0822) | 873559..873825 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
LQ195_RS04215 (AN2363V1_0823) | 873806..874216 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
LQ195_RS04220 (AN2363V1_0824) | 874225..874746 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
LQ195_RS04225 (AN2363V1_0825) | 874868..875764 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
LQ195_RS04230 (AN2363V1_0826) | 875787..876500 | + | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ195_RS04235 (AN2363V1_0827) | 876506..878239 | + | 1734 | WP_024274698.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T296185 WP_004105559.1 NZ_OW969781:873806-874216 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |