Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 653770..654362 | Replicon | chromosome |
| Accession | NZ_OW969781 | ||
| Organism | Klebsiella oxytoca isolate 328 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A7H4PHG5 |
| Locus tag | LQ195_RS03170 | Protein ID | WP_004105955.1 |
| Coordinates | 653988..654362 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A2J4YM08 |
| Locus tag | LQ195_RS03165 | Protein ID | WP_004105957.1 |
| Coordinates | 653770..653991 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ195_RS03145 (AN2363V1_0612) | 649329..649883 | + | 555 | WP_004105965.1 | YgjV family protein | - |
| LQ195_RS03150 (AN2363V1_0613) | 649900..651147 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
| LQ195_RS03155 (AN2363V1_0614) | 651402..652370 | - | 969 | WP_004115718.1 | TerC family protein | - |
| LQ195_RS03160 (AN2363V1_0615) | 652621..653610 | - | 990 | WP_070556310.1 | Gfo/Idh/MocA family oxidoreductase | - |
| LQ195_RS03165 (AN2363V1_0616) | 653770..653991 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| LQ195_RS03170 (AN2363V1_0617) | 653988..654362 | + | 375 | WP_004105955.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LQ195_RS03175 (AN2363V1_0618) | 654342..654845 | - | 504 | WP_070556312.1 | M48 family metallopeptidase | - |
| LQ195_RS03180 (AN2363V1_0619) | 654924..656567 | - | 1644 | WP_064397180.1 | glycoside hydrolase family 43 protein | - |
| LQ195_RS03185 (AN2363V1_0620) | 656696..657562 | - | 867 | WP_004105950.1 | AraC family transcriptional regulator | - |
| LQ195_RS03190 (AN2363V1_0621) | 657670..659013 | + | 1344 | WP_004105949.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13895.93 Da Isoelectric Point: 6.0769
>T296184 WP_004105955.1 NZ_OW969781:653988-654362 [Klebsiella oxytoca]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4PHG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4YM08 |