Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 60869..61416 | Replicon | chromosome |
| Accession | NZ_OW969781 | ||
| Organism | Klebsiella oxytoca isolate 328 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | LQ195_RS00300 | Protein ID | WP_064344021.1 |
| Coordinates | 60869..61177 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | LQ195_RS00305 | Protein ID | WP_064344020.1 |
| Coordinates | 61180..61416 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ195_RS00275 (AN2363V1_0055) | 56773..57084 | - | 312 | WP_004107048.1 | PTS sugar transporter subunit IIB | - |
| LQ195_RS00280 (AN2363V1_0056) | 57379..58320 | + | 942 | WP_064344024.1 | LacI family DNA-binding transcriptional regulator | - |
| LQ195_RS00285 (AN2363V1_0057) | 58344..58640 | - | 297 | WP_224250553.1 | YicS family protein | - |
| LQ195_RS00290 (AN2363V1_0058) | 58851..59813 | + | 963 | WP_024274836.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| LQ195_RS00295 (AN2363V1_0059) | 59817..60719 | - | 903 | WP_004107039.1 | DMT family transporter | - |
| LQ195_RS00300 (AN2363V1_0060) | 60869..61177 | - | 309 | WP_064344021.1 | CcdB family protein | Toxin |
| LQ195_RS00305 (AN2363V1_0061) | 61180..61416 | - | 237 | WP_064344020.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| LQ195_RS00310 (AN2363V1_0062) | 61522..62955 | - | 1434 | WP_210669531.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
| LQ195_RS00315 (AN2363V1_0063) | 62980..63882 | - | 903 | WP_004107035.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| LQ195_RS00320 (AN2363V1_0064) | 64044..65210 | - | 1167 | WP_210669532.1 | multidrug effflux MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11726.51 Da Isoelectric Point: 6.2188
>T296182 WP_064344021.1 NZ_OW969781:c61177-60869 [Klebsiella oxytoca]
MQYYVYKNTGRIAAYPYLLDVQSDIIGERNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGERNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|