Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4455603..4456219 | Replicon | chromosome |
Accession | NZ_OW969711 | ||
Organism | Citrobacter koseri isolate 0 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A427P7X6 |
Locus tag | LQV24_RS21130 | Protein ID | WP_047459878.1 |
Coordinates | 4455603..4455977 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LQV24_RS21135 | Protein ID | WP_160880417.1 |
Coordinates | 4455977..4456219 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV24_RS21115 (4453106) | 4453106..4454008 | + | 903 | WP_012133916.1 | formate dehydrogenase O subunit beta | - |
LQV24_RS21120 (4454005) | 4454005..4454640 | + | 636 | WP_049011887.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQV24_RS21125 (4454637) | 4454637..4455566 | + | 930 | WP_047459875.1 | formate dehydrogenase accessory protein FdhE | - |
LQV24_RS21130 (4455603) | 4455603..4455977 | - | 375 | WP_047459878.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQV24_RS21135 (4455977) | 4455977..4456219 | - | 243 | WP_160880417.1 | CopG family transcriptional regulator | Antitoxin |
LQV24_RS21140 (4456424) | 4456424..4457353 | + | 930 | WP_230012452.1 | alpha/beta hydrolase | - |
LQV24_RS21145 (4457405) | 4457405..4457675 | + | 271 | Protein_4135 | hypothetical protein | - |
LQV24_RS21150 (4457697) | 4457697..4458638 | - | 942 | WP_024130670.1 | fatty acid biosynthesis protein FabY | - |
LQV24_RS21155 (4458683) | 4458683..4459120 | - | 438 | WP_047459887.1 | D-aminoacyl-tRNA deacylase | - |
LQV24_RS21160 (4459117) | 4459117..4459989 | - | 873 | WP_012133924.1 | virulence factor BrkB family protein | - |
LQV24_RS21165 (4459983) | 4459983..4460582 | - | 600 | WP_104867942.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13799.04 Da Isoelectric Point: 9.4395
>T296181 WP_047459878.1 NZ_OW969711:c4455977-4455603 [Citrobacter koseri]
MIKGPVLFDTNILIDLFSGRDEAKKALEAYSPQNAISLITWMEVMVGAKKYHQESRTRIALSAFNVIGVSQDIAERSVSL
RQEYGMKLPDAVILATAHIHRFALVTRNTKDFAGIPGVITPYHL
MIKGPVLFDTNILIDLFSGRDEAKKALEAYSPQNAISLITWMEVMVGAKKYHQESRTRIALSAFNVIGVSQDIAERSVSL
RQEYGMKLPDAVILATAHIHRFALVTRNTKDFAGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|