Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3955166..3955857 | Replicon | chromosome |
Accession | NZ_OW969711 | ||
Organism | Citrobacter koseri isolate 0 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | LQV24_RS18850 | Protein ID | WP_205612697.1 |
Coordinates | 3955166..3955519 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | LQV24_RS18855 | Protein ID | WP_032686426.1 |
Coordinates | 3955540..3955857 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV24_RS18840 (3951527) | 3951527..3952897 | - | 1371 | WP_049010418.1 | tyrosine phenol-lyase | - |
LQV24_RS18845 (3953922) | 3953922..3954929 | - | 1008 | WP_230012183.1 | restriction endonuclease | - |
LQV24_RS18850 (3955166) | 3955166..3955519 | - | 354 | WP_205612697.1 | TA system toxin CbtA family protein | Toxin |
LQV24_RS18855 (3955540) | 3955540..3955857 | - | 318 | WP_032686426.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQV24_RS18860 (3955876) | 3955876..3956097 | - | 222 | WP_071602634.1 | DUF987 domain-containing protein | - |
LQV24_RS18865 (3956106) | 3956106..3956582 | - | 477 | WP_032686427.1 | RadC family protein | - |
LQV24_RS18870 (3956598) | 3956598..3957056 | - | 459 | WP_230012187.1 | antirestriction protein | - |
LQV24_RS18875 (3957142) | 3957142..3957378 | - | 237 | Protein_3699 | DUF905 domain-containing protein | - |
LQV24_RS18880 (3957456) | 3957456..3957866 | - | 411 | WP_230012190.1 | hypothetical protein | - |
LQV24_RS18885 (3957933) | 3957933..3958370 | - | 438 | WP_230012193.1 | hypothetical protein | - |
LQV24_RS18890 (3958412) | 3958412..3958948 | - | 537 | WP_230012195.1 | DUF4339 domain-containing protein | - |
LQV24_RS18895 (3958974) | 3958974..3959681 | - | 708 | WP_057067447.1 | DeoR family transcriptional regulator | - |
LQV24_RS18900 (3959890) | 3959890..3960714 | - | 825 | WP_008783817.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3955166..3986628 | 31462 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13285.26 Da Isoelectric Point: 7.2783
>T296179 WP_205612697.1 NZ_OW969711:c3955519-3955166 [Citrobacter koseri]
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKFGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAREHWE
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKFGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAREHWE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|