Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3396860..3397480 | Replicon | chromosome |
Accession | NZ_OW969711 | ||
Organism | Citrobacter koseri isolate 0 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | LQV24_RS16325 | Protein ID | WP_002892050.1 |
Coordinates | 3397262..3397480 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A8AJY4 |
Locus tag | LQV24_RS16320 | Protein ID | WP_012133514.1 |
Coordinates | 3396860..3397234 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV24_RS16310 (3391996) | 3391996..3393189 | + | 1194 | WP_049009804.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQV24_RS16315 (3393212) | 3393212..3396358 | + | 3147 | WP_012133513.1 | efflux RND transporter permease AcrB | - |
LQV24_RS16320 (3396860) | 3396860..3397234 | + | 375 | WP_012133514.1 | Hha toxicity modulator TomB | Antitoxin |
LQV24_RS16325 (3397262) | 3397262..3397480 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
LQV24_RS16330 (3397664) | 3397664..3398215 | + | 552 | WP_049009805.1 | maltose O-acetyltransferase | - |
LQV24_RS16335 (3398329) | 3398329..3398799 | + | 471 | WP_024130587.1 | YlaC family protein | - |
LQV24_RS16340 (3398877) | 3398877..3399017 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQV24_RS16345 (3399019) | 3399019..3399279 | - | 261 | WP_012133519.1 | type B 50S ribosomal protein L31 | - |
LQV24_RS16350 (3399505) | 3399505..3401055 | + | 1551 | WP_230011808.1 | EAL domain-containing protein | - |
LQV24_RS16355 (3401095) | 3401095..3401448 | - | 354 | WP_012133521.1 | DUF1428 family protein | - |
LQV24_RS16360 (3401528) | 3401528..3402142 | - | 615 | WP_012133522.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296178 WP_002892050.1 NZ_OW969711:3397262-3397480 [Citrobacter koseri]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14437.27 Da Isoelectric Point: 5.1444
>AT296178 WP_012133514.1 NZ_OW969711:3396860-3397234 [Citrobacter koseri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A8AJY4 |