Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2942099..2942838 | Replicon | chromosome |
| Accession | NZ_OW969711 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | LQV24_RS14095 | Protein ID | WP_230011416.1 |
| Coordinates | 2942099..2942584 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | LQV24_RS14100 | Protein ID | WP_230011418.1 |
| Coordinates | 2942572..2942838 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV24_RS14070 (2937371) | 2937371..2938948 | + | 1578 | WP_114848472.1 | peptidoglycan-binding domain-containing protein | - |
| LQV24_RS14075 (2938948) | 2938948..2939448 | + | 501 | WP_114848473.1 | hypothetical protein | - |
| LQV24_RS14080 (2939534) | 2939534..2940157 | - | 624 | WP_012133085.1 | helix-turn-helix domain-containing protein | - |
| LQV24_RS14085 (2940451) | 2940451..2941281 | - | 831 | WP_047457875.1 | N-acetylmuramoyl-L-alanine amidase | - |
| LQV24_RS14090 (2941278) | 2941278..2941601 | - | 324 | WP_012133087.1 | heavy metal-binding domain-containing protein | - |
| LQV24_RS14095 (2942099) | 2942099..2942584 | - | 486 | WP_230011416.1 | GNAT family N-acetyltransferase | Toxin |
| LQV24_RS14100 (2942572) | 2942572..2942838 | - | 267 | WP_230011418.1 | DUF1778 domain-containing protein | Antitoxin |
| LQV24_RS14105 (2943007) | 2943007..2944167 | + | 1161 | Protein_2767 | IS30 family transposase | - |
| LQV24_RS14110 (2944488) | 2944488..2944934 | - | 447 | WP_230011420.1 | helix-turn-helix domain-containing protein | - |
| LQV24_RS14115 (2945082) | 2945082..2945858 | + | 777 | WP_230011422.1 | SDR family oxidoreductase | - |
| LQV24_RS14120 (2945869) | 2945869..2946288 | + | 420 | WP_230011437.1 | tautomerase family protein | - |
| LQV24_RS14125 (2946540) | 2946540..2947010 | - | 471 | WP_230011440.1 | tail fiber assembly protein | - |
| LQV24_RS14130 (2947026) | 2947026..2947628 | - | 603 | WP_230011443.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2940705..2996074 | 55369 | |
| - | flank | IS/Tn | - | - | 2943505..2943978 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17831.59 Da Isoelectric Point: 10.2935
>T296177 WP_230011416.1 NZ_OW969711:c2942584-2942099 [Citrobacter koseri]
VGRVTAPEPLSAFHQVAEFVSGEAVLDNWLKQKGLKNQTLGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHRKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDNWLKQKGLKNQTLGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHRKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|