Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2307294..2307933 | Replicon | chromosome |
| Accession | NZ_OW969711 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A381H3Z1 |
| Locus tag | LQV24_RS11055 | Protein ID | WP_071818852.1 |
| Coordinates | 2307294..2307470 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQV24_RS11060 | Protein ID | WP_125337124.1 |
| Coordinates | 2307517..2307933 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV24_RS11035 (2302387) | 2302387..2303262 | + | 876 | WP_012132344.1 | AraC family transcriptional regulator | - |
| LQV24_RS11040 (2303239) | 2303239..2304405 | - | 1167 | WP_104868640.1 | benzoate/H(+) symporter BenE family transporter | - |
| LQV24_RS11045 (2304498) | 2304498..2305034 | + | 537 | WP_058669186.1 | XRE family transcriptional regulator | - |
| LQV24_RS11050 (2305113) | 2305113..2307074 | + | 1962 | WP_230011053.1 | U32 family peptidase | - |
| LQV24_RS11055 (2307294) | 2307294..2307470 | + | 177 | WP_071818852.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LQV24_RS11060 (2307517) | 2307517..2307933 | + | 417 | WP_125337124.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LQV24_RS11065 (2307982) | 2307982..2309391 | + | 1410 | WP_058669185.1 | PLP-dependent aminotransferase family protein | - |
| LQV24_RS11070 (2309711) | 2309711..2311135 | + | 1425 | WP_012132353.1 | aminobutyraldehyde dehydrogenase | - |
| LQV24_RS11075 (2311234) | 2311234..2311329 | - | 96 | WP_071818853.1 | stress response membrane protein YncL | - |
| LQV24_RS11080 (2311521) | 2311521..2311694 | + | 174 | WP_049008504.1 | GhoT/OrtT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.81 Da Isoelectric Point: 10.8122
>T296176 WP_071818852.1 NZ_OW969711:2307294-2307470 [Citrobacter koseri]
VKQSEFRRWLESQGVDVTNGTNHLKLRYHDKRSVMPRHPGDEIKDTLRKAILKQLGLN
VKQSEFRRWLESQGVDVTNGTNHLKLRYHDKRSVMPRHPGDEIKDTLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15370.62 Da Isoelectric Point: 4.4377
>AT296176 WP_125337124.1 NZ_OW969711:2307517-2307933 [Citrobacter koseri]
MRYPVNLIPAEEGGYVVSFPDIPEALTQGDTRHESLEAAQGALVTAFEFYFEDNQPIPLPSMVDEADDYVEIPLSIASKV
LLLNAFLESKITQQELARRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSLTML
MRYPVNLIPAEEGGYVVSFPDIPEALTQGDTRHESLEAAQGALVTAFEFYFEDNQPIPLPSMVDEADDYVEIPLSIASKV
LLLNAFLESKITQQELARRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSLTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|