Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 833129..833783 | Replicon | chromosome |
| Accession | NZ_OW969711 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A078LNB4 |
| Locus tag | LQV24_RS03970 | Protein ID | WP_024130921.1 |
| Coordinates | 833376..833783 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A078LG12 |
| Locus tag | LQV24_RS03965 | Protein ID | WP_024130922.1 |
| Coordinates | 833129..833395 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV24_RS03940 (828278) | 828278..829711 | - | 1434 | WP_012135007.1 | 6-phospho-beta-glucosidase BglA | - |
| LQV24_RS03945 (829832) | 829832..830560 | - | 729 | WP_012135006.1 | MurR/RpiR family transcriptional regulator | - |
| LQV24_RS03950 (830613) | 830613..830924 | + | 312 | WP_047461422.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQV24_RS03955 (831086) | 831086..831745 | + | 660 | WP_230010016.1 | hemolysin III family protein | - |
| LQV24_RS03960 (831892) | 831892..832872 | - | 981 | WP_230010019.1 | tRNA-modifying protein YgfZ | - |
| LQV24_RS03965 (833129) | 833129..833395 | + | 267 | WP_024130922.1 | FAD assembly factor SdhE | Antitoxin |
| LQV24_RS03970 (833376) | 833376..833783 | + | 408 | WP_024130921.1 | protein YgfX | Toxin |
| LQV24_RS03975 (833873) | 833873..834397 | - | 525 | WP_012134999.1 | flavodoxin FldB | - |
| LQV24_RS03980 (834501) | 834501..835397 | + | 897 | WP_012134998.1 | site-specific tyrosine recombinase XerD | - |
| LQV24_RS03985 (835421) | 835421..836134 | + | 714 | WP_012134997.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQV24_RS03990 (836140) | 836140..837873 | + | 1734 | WP_230010021.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.77 Da Isoelectric Point: 11.2845
>T296171 WP_024130921.1 NZ_OW969711:833376-833783 [Citrobacter koseri]
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LNB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LG12 |