Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4482978..4483594 | Replicon | chromosome |
Accession | NZ_OW969691 | ||
Organism | Citrobacter koseri isolate 0 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A427P7X6 |
Locus tag | LQV22_RS21265 | Protein ID | WP_047459878.1 |
Coordinates | 4482978..4483352 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LQV22_RS21270 | Protein ID | WP_160880417.1 |
Coordinates | 4483352..4483594 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV22_RS21250 (4480481) | 4480481..4481383 | + | 903 | WP_071259455.1 | formate dehydrogenase O subunit beta | - |
LQV22_RS21255 (4481380) | 4481380..4482015 | + | 636 | WP_012133917.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQV22_RS21260 (4482012) | 4482012..4482941 | + | 930 | WP_047459875.1 | formate dehydrogenase accessory protein FdhE | - |
LQV22_RS21265 (4482978) | 4482978..4483352 | - | 375 | WP_047459878.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQV22_RS21270 (4483352) | 4483352..4483594 | - | 243 | WP_160880417.1 | CopG family transcriptional regulator | Antitoxin |
LQV22_RS21275 (4483831) | 4483831..4484772 | - | 942 | WP_024130670.1 | fatty acid biosynthesis protein FabY | - |
LQV22_RS21280 (4484817) | 4484817..4485254 | - | 438 | WP_047459887.1 | D-aminoacyl-tRNA deacylase | - |
LQV22_RS21285 (4485251) | 4485251..4486123 | - | 873 | WP_230032323.1 | virulence factor BrkB family protein | - |
LQV22_RS21290 (4486117) | 4486117..4486716 | - | 600 | WP_047459890.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13799.04 Da Isoelectric Point: 9.4395
>T296169 WP_047459878.1 NZ_OW969691:c4483352-4482978 [Citrobacter koseri]
MIKGPVLFDTNILIDLFSGRDEAKKALEAYSPQNAISLITWMEVMVGAKKYHQESRTRIALSAFNVIGVSQDIAERSVSL
RQEYGMKLPDAVILATAHIHRFALVTRNTKDFAGIPGVITPYHL
MIKGPVLFDTNILIDLFSGRDEAKKALEAYSPQNAISLITWMEVMVGAKKYHQESRTRIALSAFNVIGVSQDIAERSVSL
RQEYGMKLPDAVILATAHIHRFALVTRNTKDFAGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|