Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3384191..3384811 | Replicon | chromosome |
| Accession | NZ_OW969691 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQV22_RS16115 | Protein ID | WP_002892050.1 |
| Coordinates | 3384593..3384811 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQV22_RS16110 | Protein ID | WP_214143481.1 |
| Coordinates | 3384191..3384565 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV22_RS16100 (3379327) | 3379327..3380520 | + | 1194 | WP_047458420.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQV22_RS16105 (3380543) | 3380543..3383689 | + | 3147 | WP_012133513.1 | efflux RND transporter permease AcrB | - |
| LQV22_RS16110 (3384191) | 3384191..3384565 | + | 375 | WP_214143481.1 | Hha toxicity modulator TomB | Antitoxin |
| LQV22_RS16115 (3384593) | 3384593..3384811 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQV22_RS16120 (3384995) | 3384995..3385546 | + | 552 | WP_049009805.1 | maltose O-acetyltransferase | - |
| LQV22_RS16125 (3385660) | 3385660..3386130 | + | 471 | WP_024130587.1 | YlaC family protein | - |
| LQV22_RS16130 (3386208) | 3386208..3386348 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQV22_RS16135 (3386350) | 3386350..3386610 | - | 261 | WP_012133519.1 | type B 50S ribosomal protein L31 | - |
| LQV22_RS16140 (3386836) | 3386836..3388386 | + | 1551 | WP_114847716.1 | EAL domain-containing protein | - |
| LQV22_RS16145 (3388426) | 3388426..3388779 | - | 354 | WP_012133521.1 | DUF1428 family protein | - |
| LQV22_RS16150 (3388859) | 3388859..3389473 | - | 615 | WP_101743908.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296168 WP_002892050.1 NZ_OW969691:3384593-3384811 [Citrobacter koseri]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14467.30 Da Isoelectric Point: 5.1444
>AT296168 WP_214143481.1 NZ_OW969691:3384191-3384565 [Citrobacter koseri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSTINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSTINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|