Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 839300..839954 | Replicon | chromosome |
| Accession | NZ_OW969691 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A078LNB4 |
| Locus tag | LQV22_RS04070 | Protein ID | WP_024130921.1 |
| Coordinates | 839547..839954 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A078LG12 |
| Locus tag | LQV22_RS04065 | Protein ID | WP_024130922.1 |
| Coordinates | 839300..839566 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV22_RS04040 (834441) | 834441..835874 | - | 1434 | WP_012135007.1 | 6-phospho-beta-glucosidase BglA | - |
| LQV22_RS04045 (835995) | 835995..836723 | - | 729 | WP_012135006.1 | MurR/RpiR family transcriptional regulator | - |
| LQV22_RS04050 (836776) | 836776..837087 | + | 312 | WP_012135005.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQV22_RS04055 (837249) | 837249..837908 | + | 660 | WP_012135004.1 | hemolysin III family protein | - |
| LQV22_RS04060 (838063) | 838063..839043 | - | 981 | WP_024130923.1 | tRNA-modifying protein YgfZ | - |
| LQV22_RS04065 (839300) | 839300..839566 | + | 267 | WP_024130922.1 | FAD assembly factor SdhE | Antitoxin |
| LQV22_RS04070 (839547) | 839547..839954 | + | 408 | WP_024130921.1 | protein YgfX | Toxin |
| LQV22_RS04075 (840052) | 840052..840576 | - | 525 | WP_012134999.1 | flavodoxin FldB | - |
| LQV22_RS04080 (840680) | 840680..841576 | + | 897 | WP_012134998.1 | site-specific tyrosine recombinase XerD | - |
| LQV22_RS04085 (841600) | 841600..842313 | + | 714 | WP_012134997.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQV22_RS04090 (842319) | 842319..844052 | + | 1734 | WP_012134996.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.77 Da Isoelectric Point: 11.2845
>T296161 WP_024130921.1 NZ_OW969691:839547-839954 [Citrobacter koseri]
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LNB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LG12 |