Detailed information of TA system
Overview
TA module
| Type | III | Classification (family/domain) | tenpIN/- |
| Location | 100937..101526 | Replicon | chromosome |
| Accession | NZ_OW969691 | ||
| Organism | Citrobacter koseri isolate 0 | ||
Toxin (Protein)
| Gene name | tenpN | Uniprot ID | - |
| Locus tag | LQV22_RS00455 | Protein ID | WP_230031924.1 |
| Coordinates | 101080..101526 (+) | Length | 149 a.a. |
Antitoxin (RNA)
| Gene name | tenpI | ||
| Locus tag | - | ||
| Coordinates | 100937..100983 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV22_RS00440 (96338) | 96338..98026 | - | 1689 | WP_046623974.1 | AAA family ATPase | - |
| LQV22_RS00445 (98049) | 98049..98921 | - | 873 | WP_230031922.1 | DNA adenine methylase | - |
| LQV22_RS00450 (99010) | 99010..100482 | - | 1473 | WP_230031923.1 | hypothetical protein | - |
| - (100937) | 100937..100983 | + | 47 | NuclAT_0 | - | Antitoxin |
| - (100937) | 100937..100983 | + | 47 | NuclAT_0 | - | Antitoxin |
| - (100937) | 100937..100983 | + | 47 | NuclAT_0 | - | Antitoxin |
| - (100937) | 100937..100983 | + | 47 | NuclAT_0 | - | Antitoxin |
| LQV22_RS00455 (101080) | 101080..101526 | + | 447 | WP_230031924.1 | hypothetical protein | Toxin |
| LQV22_RS00460 (101598) | 101598..102809 | - | 1212 | WP_230031925.1 | site-specific integrase | - |
| LQV22_RS00465 (103013) | 103013..103876 | - | 864 | WP_200024275.1 | YicC/YloC family endoribonuclease | - |
| LQV22_RS00470 (104002) | 104002..104718 | + | 717 | WP_012135779.1 | ribonuclease PH | - |
| LQV22_RS00475 (104783) | 104783..105424 | + | 642 | WP_024131063.1 | orotate phosphoribosyltransferase | - |
| LQV22_RS00480 (105500) | 105500..106096 | - | 597 | WP_012135776.1 | nucleoid occlusion factor SlmA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | rfaD | 80356..130351 | 49995 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 17245.12 Da Isoelectric Point: 9.6065
>T296159 WP_230031924.1 NZ_OW969691:101080-101526 [Citrobacter koseri]
MENIVMILRQIKQDVYKRLCDNRPQVLEKNRGYGVISISLNGLTFAVPLRSNLNHPNGFKTIFLKDKKIWSGLDYSKALI
VKPEDLEPEAFKLKIEKEYEKLKANKSKIEKEFEAYVQGYILFVKSGCGEEKAYKFTTLQYFHDFLGL
MENIVMILRQIKQDVYKRLCDNRPQVLEKNRGYGVISISLNGLTFAVPLRSNLNHPNGFKTIFLKDKKIWSGLDYSKALI
VKPEDLEPEAFKLKIEKEYEKLKANKSKIEKEFEAYVQGYILFVKSGCGEEKAYKFTTLQYFHDFLGL
Download Length: 447 bp
Antitoxin
Download Length: 47 bp
>AT296159 NZ_OW969691:100937-100983 [Citrobacter koseri]
GATTATGTGGCGGTAGAGGCATCCCCACGTTAAATAGAACAACCTCA
GATTATGTGGCGGTAGAGGCATCCCCACGTTAAATAGAACAACCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|