Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 139716..140452 | Replicon | plasmid P1 |
| Accession | NZ_OW969660 | ||
| Organism | Klebsiella oxytoca isolate 36 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | LQ206_RS27990 | Protein ID | WP_003026803.1 |
| Coordinates | 139970..140452 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LQ206_RS27985 | Protein ID | WP_003026799.1 |
| Coordinates | 139716..139982 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ206_RS27950 (AI2918V1_5445) | 135560..135922 | - | 363 | WP_004206665.1 | arsenite efflux transporter metallochaperone ArsD | - |
| LQ206_RS27955 (AI2918V1_5446) | 135974..136324 | - | 351 | WP_004206664.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| LQ206_RS27960 (AI2918V1_5447) | 136682..136930 | + | 249 | WP_004193994.1 | hypothetical protein | - |
| LQ206_RS27965 (AI2918V1_5448) | 136927..138138 | + | 1212 | WP_032415728.1 | hypothetical protein | - |
| LQ206_RS27970 (AI2918V1_5449) | 138272..138763 | + | 492 | WP_004206662.1 | hypothetical protein | - |
| LQ206_RS27975 (AI2918V1_5450) | 138824..139027 | + | 204 | WP_004206661.1 | HHA domain-containing protein | - |
| LQ206_RS27980 (AI2918V1_5451) | 139041..139271 | + | 231 | WP_004206660.1 | hypothetical protein | - |
| LQ206_RS27985 (AI2918V1_5452) | 139716..139982 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ206_RS27990 (AI2918V1_5453) | 139970..140452 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| LQ206_RS27995 (AI2918V1_5454) | 140653..142056 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| LQ206_RS28000 (AI2918V1_5455) | 142085..142717 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| LQ206_RS28005 (AI2918V1_5456) | 142936..144339 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| LQ206_RS28010 (AI2918V1_5457) | 144368..145000 | - | 633 | WP_001567369.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..165787 | 165787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T296158 WP_003026803.1 NZ_OW969660:139970-140452 [Klebsiella oxytoca]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |