Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 97855..98498 Replicon plasmid P1
Accession NZ_OW969660
Organism Klebsiella oxytoca isolate 36

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag LQ206_RS27765 Protein ID WP_001044770.1
Coordinates 98082..98498 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag LQ206_RS27760 Protein ID WP_001261282.1
Coordinates 97855..98085 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ206_RS27730 (AI2918V1_5404) 93031..94359 + 1329 WP_004206607.1 nucleotidyltransferase -
LQ206_RS27735 (AI2918V1_5405) 94367..94942 + 576 WP_004206608.1 SLATT domain-containing protein -
LQ206_RS27740 (AI2918V1_5406) 95162..96700 - 1539 WP_016808813.1 IS66 family transposase -
LQ206_RS27745 (AI2918V1_5407) 96750..97097 - 348 WP_004114612.1 IS66 family insertion sequence element accessory protein TnpB -
LQ206_RS27750 (AI2918V1_5408) 97094..97471 - 378 WP_004114613.1 transposase -
LQ206_RS27755 97656..97898 - 243 Protein_117 hypothetical protein -
LQ206_RS27760 (AI2918V1_5409) 97855..98085 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ206_RS27765 (AI2918V1_5410) 98082..98498 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ206_RS27770 (AI2918V1_5411) 98572..100134 + 1563 WP_004206609.1 AAA family ATPase -
LQ206_RS27775 (AI2918V1_5412) 100119..101141 + 1023 WP_000361404.1 helicase UvrD -
LQ206_RS27780 (AI2918V1_5413) 101685..102593 + 909 WP_032426221.1 HNH endonuclease -
LQ206_RS27785 (AI2918V1_5415) 102779..103129 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B mrkA / mrkB / mrkC / mrkF / mrkJ 1..165787 165787


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T296157 WP_001044770.1 NZ_OW969660:98082-98498 [Klebsiella oxytoca]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT296157 WP_001261282.1 NZ_OW969660:97855-98085 [Klebsiella oxytoca]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References