Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 5337808..5338583 | Replicon | chromosome |
Accession | NZ_OW969659 | ||
Organism | Klebsiella oxytoca isolate 36 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | LQ206_RS24950 | Protein ID | WP_064350014.1 |
Coordinates | 5337808..5338293 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | LQ206_RS24955 | Protein ID | WP_016809050.1 |
Coordinates | 5338290..5338583 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ206_RS24930 | 5333306..5333602 | + | 297 | Protein_4902 | site-specific integrase | - |
LQ206_RS24935 (AI2918V1_4886) | 5333840..5334823 | - | 984 | WP_016809046.1 | hypothetical protein | - |
LQ206_RS24940 (AI2918V1_4887) | 5335338..5336369 | + | 1032 | Protein_4904 | IS630 family transposase | - |
LQ206_RS24945 | 5336724..5336974 | + | 251 | Protein_4905 | hypothetical protein | - |
LQ206_RS24950 (AI2918V1_4888) | 5337808..5338293 | - | 486 | WP_064350014.1 | GNAT family N-acetyltransferase | Toxin |
LQ206_RS24955 (AI2918V1_4889) | 5338290..5338583 | - | 294 | WP_016809050.1 | DUF1778 domain-containing protein | Antitoxin |
LQ206_RS24960 (AI2918V1_4890) | 5338864..5339451 | - | 588 | WP_016809051.1 | NAD(P)H-dependent oxidoreductase | - |
LQ206_RS24965 (AI2918V1_4891) | 5339567..5340187 | + | 621 | WP_016809052.1 | TetR/AcrR family transcriptional regulator | - |
LQ206_RS24970 (AI2918V1_4892) | 5340256..5341038 | - | 783 | WP_004109379.1 | DsbA family protein | - |
LQ206_RS24975 (AI2918V1_4893) | 5341261..5341944 | + | 684 | WP_004109381.1 | TerC family protein | - |
LQ206_RS24980 (AI2918V1_4894) | 5342094..5343011 | + | 918 | WP_004109383.1 | curved DNA-binding protein | - |
LQ206_RS24985 (AI2918V1_4895) | 5343011..5343316 | + | 306 | WP_004109388.1 | chaperone modulator CbpM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5343554..5344576 | 1022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17541.43 Da Isoelectric Point: 7.8024
>T296156 WP_064350014.1 NZ_OW969659:c5338293-5337808 [Klebsiella oxytoca]
MISAPEPLQAGHILTPFYCGVDSMDNWLKQRAMKNQLSGASRTFVCCDDAKVMAYYSLASSAVATNTAPGRFRRNMPDPI
PVVVLGRLAVDRTLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMMLMVTLGDLVH
A
MISAPEPLQAGHILTPFYCGVDSMDNWLKQRAMKNQLSGASRTFVCCDDAKVMAYYSLASSAVATNTAPGRFRRNMPDPI
PVVVLGRLAVDRTLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMMLMVTLGDLVH
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|