Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4593731..4594550 | Replicon | chromosome |
Accession | NZ_OW969659 | ||
Organism | Klebsiella oxytoca isolate 36 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | LQ206_RS21575 | Protein ID | WP_004110819.1 |
Coordinates | 4594293..4594550 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | LQ206_RS21570 | Protein ID | WP_016809596.1 |
Coordinates | 4593731..4594282 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ206_RS21535 (AI2918V1_4230) | 4588735..4589778 | + | 1044 | WP_016809310.1 | alpha/beta hydrolase | - |
LQ206_RS21540 (AI2918V1_4231) | 4589846..4590274 | + | 429 | WP_016809309.1 | cyclophilin-like fold protein | - |
LQ206_RS21545 (AI2918V1_4232) | 4590467..4591000 | - | 534 | Protein_4244 | MFS transporter | - |
LQ206_RS21550 | 4591503..4591706 | - | 204 | Protein_4245 | VOC family protein | - |
LQ206_RS21555 (AI2918V1_4233) | 4591706..4591915 | - | 210 | WP_196089984.1 | hypothetical protein | - |
LQ206_RS21560 | 4592085..4592849 | - | 765 | WP_224226441.1 | class I SAM-dependent methyltransferase | - |
LQ206_RS21565 | 4593243..4593617 | - | 375 | Protein_4248 | class I SAM-dependent methyltransferase | - |
LQ206_RS21570 (AI2918V1_4235) | 4593731..4594282 | - | 552 | WP_016809596.1 | N-acetyltransferase | Antitoxin |
LQ206_RS21575 (AI2918V1_4236) | 4594293..4594550 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
LQ206_RS21580 (AI2918V1_4237) | 4595132..4596316 | + | 1185 | WP_016809597.1 | mannonate dehydratase | - |
LQ206_RS21585 (AI2918V1_4238) | 4596391..4597866 | + | 1476 | WP_004110817.1 | fructuronate reductase | - |
LQ206_RS21590 (AI2918V1_4239) | 4598002..4598778 | + | 777 | WP_004099223.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T296155 WP_004110819.1 NZ_OW969659:c4594550-4594293 [Klebsiella oxytoca]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20169.01 Da Isoelectric Point: 6.8799
>AT296155 WP_016809596.1 NZ_OW969659:c4594282-4593731 [Klebsiella oxytoca]
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
MTNHNFTFHITSERDADDIREVETRAFGFSKEADLVAALLNDESAHPSLSLLAKHNGKAVGHILFTLATFKGESDSPMMH
ILAPLAVVPEYQGVGVGGLLIQRGIEHLKAAGSEAVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMLQRLSS
RPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|