Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4323755..4324374 | Replicon | chromosome |
| Accession | NZ_OW969659 | ||
| Organism | Klebsiella oxytoca isolate 36 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | LQ206_RS20265 | Protein ID | WP_004099646.1 |
| Coordinates | 4324156..4324374 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQ206_RS20260 | Protein ID | WP_004099648.1 |
| Coordinates | 4323755..4324129 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ206_RS20250 (AI2918V1_3979) | 4318911..4320104 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ206_RS20255 (AI2918V1_3980) | 4320127..4323273 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ206_RS20260 (AI2918V1_3981) | 4323755..4324129 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ206_RS20265 (AI2918V1_3982) | 4324156..4324374 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| LQ206_RS20270 (AI2918V1_3983) | 4324535..4325101 | + | 567 | WP_230133288.1 | maltose O-acetyltransferase | - |
| LQ206_RS20275 | 4325070..4325207 | - | 138 | WP_224226720.1 | hypothetical protein | - |
| LQ206_RS20280 (AI2918V1_3984) | 4325238..4325708 | + | 471 | WP_004111038.1 | YlaC family protein | - |
| LQ206_RS20285 (AI2918V1_3985) | 4325683..4327137 | - | 1455 | WP_016808702.1 | PLP-dependent aminotransferase family protein | - |
| LQ206_RS20290 (AI2918V1_3986) | 4327240..4327938 | + | 699 | WP_004099639.1 | GNAT family protein | - |
| LQ206_RS20295 (AI2918V1_3987) | 4327935..4328075 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ206_RS20300 (AI2918V1_3988) | 4328075..4328338 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T296154 WP_004099646.1 NZ_OW969659:4324156-4324374 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT296154 WP_004099648.1 NZ_OW969659:4323755-4324129 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|