Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 886018..886675 | Replicon | chromosome |
Accession | NZ_OW969659 | ||
Organism | Klebsiella oxytoca isolate 36 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | LQ206_RS04275 | Protein ID | WP_004105559.1 |
Coordinates | 886265..886675 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | LQ206_RS04270 | Protein ID | WP_004105561.1 |
Coordinates | 886018..886284 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ206_RS04255 (AI2918V1_0831) | 881271..881696 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
LQ206_RS04260 (AI2918V1_0832) | 881817..884615 | - | 2799 | WP_016809675.1 | transcriptional regulator DagR | - |
LQ206_RS04265 (AI2918V1_0833) | 884797..885774 | - | 978 | WP_016809676.1 | tRNA-modifying protein YgfZ | - |
LQ206_RS04270 (AI2918V1_0835) | 886018..886284 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
LQ206_RS04275 (AI2918V1_0836) | 886265..886675 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
LQ206_RS04280 (AI2918V1_0837) | 886684..887205 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
LQ206_RS04285 (AI2918V1_0838) | 887327..888223 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
LQ206_RS04290 (AI2918V1_0839) | 888246..888959 | + | 714 | WP_016809677.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ206_RS04295 (AI2918V1_0840) | 888965..890698 | + | 1734 | WP_016809678.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T296149 WP_004105559.1 NZ_OW969659:886265-886675 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |