Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 658400..658992 | Replicon | chromosome |
| Accession | NZ_OW969659 | ||
| Organism | Klebsiella oxytoca isolate 36 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | LQ206_RS03190 | Protein ID | WP_016808034.1 |
| Coordinates | 658618..658992 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A2J4YM08 |
| Locus tag | LQ206_RS03185 | Protein ID | WP_004105957.1 |
| Coordinates | 658400..658621 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ206_RS03165 (AI2918V1_0617) | 653961..654515 | + | 555 | WP_004105965.1 | YgjV family protein | - |
| LQ206_RS03170 (AI2918V1_0618) | 654530..655777 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
| LQ206_RS03175 (AI2918V1_0619) | 656032..657000 | - | 969 | WP_004115718.1 | TerC family protein | - |
| LQ206_RS03180 (AI2918V1_0620) | 657251..658240 | - | 990 | WP_016808035.1 | Gfo/Idh/MocA family oxidoreductase | - |
| LQ206_RS03185 (AI2918V1_0621) | 658400..658621 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| LQ206_RS03190 (AI2918V1_0622) | 658618..658992 | + | 375 | WP_016808034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LQ206_RS03195 (AI2918V1_0623) | 658972..659475 | - | 504 | WP_004105953.1 | M48 family metallopeptidase | - |
| LQ206_RS03200 (AI2918V1_0624) | 659554..661197 | - | 1644 | WP_016808033.1 | glycoside hydrolase family 43 protein | - |
| LQ206_RS03205 (AI2918V1_0625) | 661326..662192 | - | 867 | WP_004105950.1 | AraC family transcriptional regulator | - |
| LQ206_RS03210 (AI2918V1_0626) | 662300..663643 | + | 1344 | WP_016808032.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13835.89 Da Isoelectric Point: 6.0752
>T296148 WP_016808034.1 NZ_OW969659:658618-658992 [Klebsiella oxytoca]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|