Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3804284..3804903 | Replicon | chromosome |
| Accession | NZ_OW969633 | ||
| Organism | Klebsiella aerogenes isolate 57 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
| Locus tag | LQ131_RS18105 | Protein ID | WP_015367918.1 |
| Coordinates | 3804685..3804903 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0H3FPM3 |
| Locus tag | LQ131_RS18100 | Protein ID | WP_015367917.1 |
| Coordinates | 3804284..3804658 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ131_RS18090 (3799443) | 3799443..3800642 | + | 1200 | WP_047038885.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ131_RS18095 (3800665) | 3800665..3803811 | + | 3147 | WP_015367916.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ131_RS18100 (3804284) | 3804284..3804658 | + | 375 | WP_015367917.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ131_RS18105 (3804685) | 3804685..3804903 | + | 219 | WP_015367918.1 | HHA domain-containing protein | Toxin |
| LQ131_RS18110 (3805035) | 3805035..3805598 | + | 564 | WP_020079452.1 | maltose O-acetyltransferase | - |
| LQ131_RS18115 (3805724) | 3805724..3806188 | + | 465 | WP_230132976.1 | YlaC family protein | - |
| LQ131_RS18120 (3806163) | 3806163..3807617 | - | 1455 | WP_045361851.1 | PLP-dependent aminotransferase family protein | - |
| LQ131_RS18125 (3807720) | 3807720..3808430 | + | 711 | WP_015704607.1 | GNAT family protein | - |
| LQ131_RS18130 (3808427) | 3808427..3808567 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ131_RS18135 (3808570) | 3808570..3808830 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T296147 WP_015367918.1 NZ_OW969633:3804685-3804903 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.21 Da Isoelectric Point: 4.9045
>AT296147 WP_015367917.1 NZ_OW969633:3804284-3804658 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FPM3 |