Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2536868..2537607 | Replicon | chromosome |
Accession | NZ_OW969633 | ||
Organism | Klebsiella aerogenes isolate 57 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0H3G0L6 |
Locus tag | LQ131_RS12050 | Protein ID | WP_015705365.1 |
Coordinates | 2537122..2537607 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A0H3FSM9 |
Locus tag | LQ131_RS12045 | Protein ID | WP_015705366.1 |
Coordinates | 2536868..2537134 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ131_RS12020 (2532203) | 2532203..2532790 | + | 588 | WP_032705775.1 | hypothetical protein | - |
LQ131_RS12025 (2532787) | 2532787..2534106 | + | 1320 | WP_045360842.1 | ATP-binding protein | - |
LQ131_RS12030 (2534106) | 2534106..2534723 | + | 618 | WP_045360840.1 | response regulator | - |
LQ131_RS12035 (2534819) | 2534819..2535316 | + | 498 | WP_230132898.1 | heme-binding protein | - |
LQ131_RS12040 (2535360) | 2535360..2536595 | - | 1236 | WP_230132899.1 | MFS transporter | - |
LQ131_RS12045 (2536868) | 2536868..2537134 | + | 267 | WP_015705366.1 | DUF1778 domain-containing protein | Antitoxin |
LQ131_RS12050 (2537122) | 2537122..2537607 | + | 486 | WP_015705365.1 | GNAT family N-acetyltransferase | Toxin |
LQ131_RS12055 (2537679) | 2537679..2539295 | + | 1617 | WP_157195350.1 | FAD-NAD(P)-binding protein | - |
LQ131_RS12060 (2539414) | 2539414..2540514 | + | 1101 | WP_015705363.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
LQ131_RS12065 (2540571) | 2540571..2540729 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
LQ131_RS12070 (2540990) | 2540990..2542060 | + | 1071 | WP_046883609.1 | mannonate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17603.25 Da Isoelectric Point: 8.8590
>T296146 WP_015705365.1 NZ_OW969633:2537122-2537607 [Klebsiella aerogenes]
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3G0L6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FSM9 |