Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 854662..855319 | Replicon | chromosome |
Accession | NZ_OW969633 | ||
Organism | Klebsiella aerogenes isolate 57 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | LQ131_RS04115 | Protein ID | WP_020077981.1 |
Coordinates | 854909..855319 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0H3FJK6 |
Locus tag | LQ131_RS04110 | Protein ID | WP_015369791.1 |
Coordinates | 854662..854928 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ131_RS04085 (849889) | 849889..851322 | - | 1434 | WP_230132708.1 | 6-phospho-beta-glucosidase BglA | - |
LQ131_RS04090 (851442) | 851442..852170 | - | 729 | WP_020077980.1 | MurR/RpiR family transcriptional regulator | - |
LQ131_RS04095 (852221) | 852221..852532 | + | 312 | WP_015703422.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ131_RS04100 (852697) | 852697..853356 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
LQ131_RS04105 (853455) | 853455..854438 | - | 984 | WP_015369790.1 | tRNA-modifying protein YgfZ | - |
LQ131_RS04110 (854662) | 854662..854928 | + | 267 | WP_015369791.1 | FAD assembly factor SdhE | Antitoxin |
LQ131_RS04115 (854909) | 854909..855319 | + | 411 | WP_020077981.1 | protein YgfX | Toxin |
LQ131_RS04120 (855327) | 855327..855848 | - | 522 | WP_015369793.1 | flavodoxin FldB | - |
LQ131_RS04125 (855949) | 855949..856845 | + | 897 | WP_015703420.1 | site-specific tyrosine recombinase XerD | - |
LQ131_RS04130 (856868) | 856868..857581 | + | 714 | WP_015369795.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ131_RS04135 (857587) | 857587..859320 | + | 1734 | WP_032715785.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15873.66 Da Isoelectric Point: 10.0200
>T296140 WP_020077981.1 NZ_OW969633:854909-855319 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAESGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAESGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|