Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 60301..60944 | Replicon | plasmid P1 |
| Accession | NZ_OW968432 | ||
| Organism | Klebsiella quasipneumoniae isolate 0 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A6H2GRP8 |
| Locus tag | LQ152_RS25065 | Protein ID | WP_023292131.1 |
| Coordinates | 60528..60944 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A6B7Q5S4 |
| Locus tag | LQ152_RS25060 | Protein ID | WP_021312476.1 |
| Coordinates | 60301..60531 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ152_RS25050 (AI3010V1_4778) | 57007..57090 | - | 84 | Protein_60 | HEPN family nuclease | - |
| LQ152_RS25055 (AI3010V1_4779) | 57458..59668 | + | 2211 | WP_023292130.1 | AAA family ATPase | - |
| LQ152_RS25060 (AI3010V1_4780) | 60301..60531 | + | 231 | WP_021312476.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ152_RS25065 (AI3010V1_4781) | 60528..60944 | + | 417 | WP_023292131.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ152_RS25070 (AI3010V1_4782) | 61042..61368 | + | 327 | WP_023292132.1 | hypothetical protein | - |
| LQ152_RS25075 (AI3010V1_REPA000000008) | 61437..61598 | - | 162 | Protein_65 | IS1 family transposase | - |
| LQ152_RS25080 (AI3010V1_REPA000000007) | 61656..62558 | - | 903 | Protein_66 | IS5 family transposase | - |
| LQ152_RS25085 (AI3010V1_4784) | 62669..62941 | - | 273 | WP_023292134.1 | YkgJ family cysteine cluster protein | - |
| LQ152_RS25090 (AI3010V1_4785) | 62938..64509 | - | 1572 | WP_023292135.1 | hypothetical protein | - |
| LQ152_RS25095 (AI3010V1_4786) | 64556..65653 | - | 1098 | WP_023292136.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..131788 | 131788 | |
| - | inside | IScluster/Tn | - | - | 55798..66808 | 11010 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14975.40 Da Isoelectric Point: 8.5464
>T296139 WP_023292131.1 NZ_OW968432:60528-60944 [Klebsiella quasipneumoniae]
VKKTFMLDTNICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
VKKTFMLDTNICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H2GRP8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B7Q5S4 |