Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 40907..41643 | Replicon | plasmid P1 |
Accession | NZ_OW968432 | ||
Organism | Klebsiella quasipneumoniae isolate 0 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | LQ152_RS24970 | Protein ID | WP_032429294.1 |
Coordinates | 41161..41643 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | LQ152_RS24965 | Protein ID | WP_003026799.1 |
Coordinates | 40907..41173 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ152_RS24930 (AI3010V1_4755) | 36751..37113 | - | 363 | WP_004206665.1 | arsenite efflux transporter metallochaperone ArsD | - |
LQ152_RS24935 (AI3010V1_4756) | 37165..37515 | - | 351 | WP_004206664.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
LQ152_RS24940 (AI3010V1_4757) | 37873..38121 | + | 249 | WP_004193994.1 | hypothetical protein | - |
LQ152_RS24945 (AI3010V1_4758) | 38118..39329 | + | 1212 | WP_032415728.1 | hypothetical protein | - |
LQ152_RS24950 (AI3010V1_4759) | 39463..39954 | + | 492 | WP_004206662.1 | hypothetical protein | - |
LQ152_RS24955 | 40015..40218 | + | 204 | WP_004206661.1 | HHA domain-containing protein | - |
LQ152_RS24960 (AI3010V1_4760) | 40232..40462 | + | 231 | WP_004206660.1 | hypothetical protein | - |
LQ152_RS24965 (AI3010V1_4761) | 40907..41173 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
LQ152_RS24970 | 41161..41643 | + | 483 | WP_032429294.1 | GNAT family N-acetyltransferase | Toxin |
LQ152_RS24975 (AI3010V1_4762) | 42060..43157 | - | 1098 | WP_023292115.1 | LacI family DNA-binding transcriptional regulator | - |
LQ152_RS24980 (AI3010V1_4763) | 43388..44425 | + | 1038 | WP_023292116.1 | SIS domain-containing protein | - |
LQ152_RS24985 (AI3010V1_4764) | 44431..45261 | + | 831 | WP_023292117.1 | PfkB family carbohydrate kinase | - |
LQ152_RS24990 (AI3010V1_4765) | 45327..46082 | + | 756 | WP_023292118.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..131788 | 131788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17368.00 Da Isoelectric Point: 9.5822
>T296138 WP_032429294.1 NZ_OW968432:41161-41643 [Klebsiella quasipneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAAFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAAFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|