Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4575312..4575828 | Replicon | chromosome |
| Accession | NZ_OW968431 | ||
| Organism | Klebsiella quasipneumoniae isolate 0 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A5MHL2 |
| Locus tag | LQ152_RS22180 | Protein ID | WP_050533673.1 |
| Coordinates | 4575312..4575596 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | LQ152_RS22185 | Protein ID | WP_002886901.1 |
| Coordinates | 4575586..4575828 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ152_RS22165 (4570420) | 4570420..4572075 | + | 1656 | WP_048322789.1 | alpha,alpha-phosphotrehalase | - |
| LQ152_RS22170 (4572461) | 4572461..4574599 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQ152_RS22175 (4574844) | 4574844..4575308 | + | 465 | WP_050533674.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQ152_RS22180 (4575312) | 4575312..4575596 | - | 285 | WP_050533673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ152_RS22185 (4575586) | 4575586..4575828 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQ152_RS22190 (4575906) | 4575906..4577816 | - | 1911 | WP_004206509.1 | PRD domain-containing protein | - |
| LQ152_RS22195 (4577839) | 4577839..4578990 | - | 1152 | WP_230128777.1 | lactonase family protein | - |
| LQ152_RS22200 (4579057) | 4579057..4579797 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11093.90 Da Isoelectric Point: 10.3341
>T296137 WP_050533673.1 NZ_OW968431:c4575596-4575312 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCDKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCDKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MHL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |