Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3862440..3863059 Replicon chromosome
Accession NZ_OW968431
Organism Klebsiella quasipneumoniae isolate 0

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LQ152_RS18785 Protein ID WP_002892050.1
Coordinates 3862841..3863059 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LQ152_RS18780 Protein ID WP_002892066.1
Coordinates 3862440..3862814 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ152_RS18770 (3857593) 3857593..3858786 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LQ152_RS18775 (3858809) 3858809..3861955 + 3147 WP_004204748.1 multidrug efflux RND transporter permease subunit AcrB -
LQ152_RS18780 (3862440) 3862440..3862814 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LQ152_RS18785 (3862841) 3862841..3863059 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LQ152_RS18790 (3863217) 3863217..3863783 + 567 WP_004204750.1 maltose O-acetyltransferase -
LQ152_RS18795 (3863755) 3863755..3863877 - 123 WP_032426076.1 hypothetical protein -
LQ152_RS18800 (3863920) 3863920..3864390 + 471 WP_004204751.1 YlaC family protein -
LQ152_RS18805 (3864359) 3864359..3865816 - 1458 WP_049117056.1 PLP-dependent aminotransferase family protein -
LQ152_RS18810 (3865917) 3865917..3866615 + 699 WP_004204753.1 GNAT family protein -
LQ152_RS18815 (3866612) 3866612..3866752 - 141 WP_182972050.1 type B 50S ribosomal protein L36 -
LQ152_RS18820 (3866752) 3866752..3867015 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296136 WP_002892050.1 NZ_OW968431:3862841-3863059 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296136 WP_002892066.1 NZ_OW968431:3862440-3862814 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References