Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 9296..9939 | Replicon | plasmid P3 |
| Accession | NZ_OW968420 | ||
| Organism | Enterobacter cloacae isolate 764 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A155IU92 |
| Locus tag | LQ125_RS25285 | Protein ID | WP_000754567.1 |
| Coordinates | 9523..9939 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A155IUD1 |
| Locus tag | LQ125_RS25280 | Protein ID | WP_023293777.1 |
| Coordinates | 9296..9526 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ125_RS25240 (AI3013V2_4896) | 4329..4958 | + | 630 | WP_072162194.1 | YkgJ family cysteine cluster protein | - |
| LQ125_RS25245 | 5050..5280 | + | 231 | WP_011977773.1 | hypothetical protein | - |
| LQ125_RS25250 (AI3013V2_4897) | 6172..6954 | - | 783 | WP_004152340.1 | site-specific integrase | - |
| LQ125_RS25255 (AI3013V2_4898) | 6954..7286 | - | 333 | WP_004152339.1 | hypothetical protein | - |
| LQ125_RS25260 (AI3013V2_4899) | 7293..7691 | - | 399 | WP_004171440.1 | hypothetical protein | - |
| LQ125_RS25265 (AI3013V2_4900) | 7717..8046 | - | 330 | WP_004152337.1 | hypothetical protein | - |
| LQ125_RS25270 (AI3013V2_4901) | 8074..8382 | - | 309 | WP_004152336.1 | hypothetical protein | - |
| LQ125_RS25275 (AI3013V2_4902) | 8428..8634 | - | 207 | WP_004153649.1 | hypothetical protein | - |
| LQ125_RS25280 (AI3013V2_4903) | 9296..9526 | + | 231 | WP_023293777.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ125_RS25285 (AI3013V2_4904) | 9523..9939 | + | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ125_RS25290 (AI3013V2_4905) | 10290..11258 | - | 969 | WP_016151349.1 | IS5 family transposase | - |
| LQ125_RS25295 | 11418..11681 | + | 264 | WP_001295708.1 | hypothetical protein | - |
| LQ125_RS25300 (AI3013V2_4907) | 11875..12156 | + | 282 | WP_023332908.1 | helix-turn-helix domain-containing protein | - |
| LQ125_RS25305 (AI3013V2_4908) | 12191..12760 | + | 570 | WP_023332907.1 | small heat shock protein sHSP20 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..78017 | 78017 | |
| - | flank | IS/Tn | - | - | 10290..11213 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15108.61 Da Isoelectric Point: 8.5403
>T296129 WP_000754567.1 NZ_OW968420:9523-9939 [Enterobacter cloacae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A155IU92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A155IUD1 |