Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 9296..9939 Replicon plasmid P3
Accession NZ_OW968420
Organism Enterobacter cloacae isolate 764

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag LQ125_RS25285 Protein ID WP_000754567.1
Coordinates 9523..9939 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag LQ125_RS25280 Protein ID WP_023293777.1
Coordinates 9296..9526 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ125_RS25240 (AI3013V2_4896) 4329..4958 + 630 WP_072162194.1 YkgJ family cysteine cluster protein -
LQ125_RS25245 5050..5280 + 231 WP_011977773.1 hypothetical protein -
LQ125_RS25250 (AI3013V2_4897) 6172..6954 - 783 WP_004152340.1 site-specific integrase -
LQ125_RS25255 (AI3013V2_4898) 6954..7286 - 333 WP_004152339.1 hypothetical protein -
LQ125_RS25260 (AI3013V2_4899) 7293..7691 - 399 WP_004171440.1 hypothetical protein -
LQ125_RS25265 (AI3013V2_4900) 7717..8046 - 330 WP_004152337.1 hypothetical protein -
LQ125_RS25270 (AI3013V2_4901) 8074..8382 - 309 WP_004152336.1 hypothetical protein -
LQ125_RS25275 (AI3013V2_4902) 8428..8634 - 207 WP_004153649.1 hypothetical protein -
LQ125_RS25280 (AI3013V2_4903) 9296..9526 + 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ125_RS25285 (AI3013V2_4904) 9523..9939 + 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ125_RS25290 (AI3013V2_4905) 10290..11258 - 969 WP_016151349.1 IS5 family transposase -
LQ125_RS25295 11418..11681 + 264 WP_001295708.1 hypothetical protein -
LQ125_RS25300 (AI3013V2_4907) 11875..12156 + 282 WP_023332908.1 helix-turn-helix domain-containing protein -
LQ125_RS25305 (AI3013V2_4908) 12191..12760 + 570 WP_023332907.1 small heat shock protein sHSP20 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..78017 78017
- flank IS/Tn - - 10290..11213 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T296129 WP_000754567.1 NZ_OW968420:9523-9939 [Enterobacter cloacae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT296129 WP_023293777.1 NZ_OW968420:9296-9526 [Enterobacter cloacae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References