Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 57474..58117 Replicon plasmid P2
Accession NZ_OW968419
Organism Enterobacter cloacae isolate 764

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag LQ125_RS24425 Protein ID WP_008322233.1
Coordinates 57701..58117 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQ125_RS24420 Protein ID WP_001261276.1
Coordinates 57474..57704 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ125_RS24390 (AI3013V2_4731) 53302..53562 - 261 WP_040219223.1 type II toxin-antitoxin system ParD family antitoxin -
LQ125_RS24395 53686..53811 - 126 Protein_67 hypothetical protein -
LQ125_RS24400 (AI3013V2_4732) 53935..54165 + 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin -
LQ125_RS24405 (AI3013V2_4733) 54162..54578 + 417 WP_071687807.1 type II toxin-antitoxin system VapC family toxin -
LQ125_RS24410 (AI3013V2_4734) 54652..56214 + 1563 WP_008322224.1 AAA family ATPase -
LQ125_RS24415 (AI3013V2_4735) 56199..57221 + 1023 WP_008322227.1 helicase UvrD -
LQ125_RS24420 (AI3013V2_4736) 57474..57704 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ125_RS24425 (AI3013V2_4737) 57701..58117 + 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ125_RS24430 (AI3013V2_4739) 58663..59583 - 921 WP_071687809.1 carbohydrate kinase -
LQ125_RS24435 (AI3013V2_4740) 59580..60950 - 1371 WP_008322237.1 hypothetical protein -
LQ125_RS24440 (AI3013V2_4741) 61028..62047 - 1020 WP_004113181.1 ribose ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aadA2 mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA 1..196573 196573
- flank IS/Tn - - 52258..53226 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T296128 WP_008322233.1 NZ_OW968419:57701-58117 [Enterobacter cloacae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT296128 WP_001261276.1 NZ_OW968419:57474-57704 [Enterobacter cloacae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References