Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 53935..54578 | Replicon | plasmid P2 |
| Accession | NZ_OW968419 | ||
| Organism | Enterobacter cloacae isolate 764 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | LQ125_RS24405 | Protein ID | WP_071687807.1 |
| Coordinates | 54162..54578 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A6C0NE67 |
| Locus tag | LQ125_RS24400 | Protein ID | WP_008322219.1 |
| Coordinates | 53935..54165 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ125_RS24370 | 49190..49513 | + | 324 | WP_000143877.1 | hypothetical protein | - |
| LQ125_RS24375 (AI3013V2_4728) | 49563..50936 | + | 1374 | WP_040219225.1 | RES family NAD+ phosphorylase | - |
| LQ125_RS24380 (AI3013V2_4729) | 50985..52202 | - | 1218 | Protein_64 | Y-family DNA polymerase | - |
| LQ125_RS24385 (AI3013V2_4730) | 52258..53226 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
| LQ125_RS24390 (AI3013V2_4731) | 53302..53562 | - | 261 | WP_040219223.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| LQ125_RS24395 | 53686..53811 | - | 126 | Protein_67 | hypothetical protein | - |
| LQ125_RS24400 (AI3013V2_4732) | 53935..54165 | + | 231 | WP_008322219.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ125_RS24405 (AI3013V2_4733) | 54162..54578 | + | 417 | WP_071687807.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ125_RS24410 (AI3013V2_4734) | 54652..56214 | + | 1563 | WP_008322224.1 | AAA family ATPase | - |
| LQ125_RS24415 (AI3013V2_4735) | 56199..57221 | + | 1023 | WP_008322227.1 | helicase UvrD | - |
| LQ125_RS24420 (AI3013V2_4736) | 57474..57704 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| LQ125_RS24425 (AI3013V2_4737) | 57701..58117 | + | 417 | WP_008322233.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / aadA2 | mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA | 1..196573 | 196573 | |
| - | flank | IS/Tn | - | - | 52258..53226 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15156.50 Da Isoelectric Point: 7.1361
>T296127 WP_071687807.1 NZ_OW968419:54162-54578 [Enterobacter cloacae]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEVRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEVRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|